4F7G: Talin autoinhibition complex

Name: PDB 4F7G: Crystal structure of talin autoinhibition complex
Published: 2012-07-04
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: cell adhesion

Crystal structure of talin autoinhibition complex. Determined by X-ray diffraction at 2.05 Å resolution. Released 4 Jul 2012.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Mus musculus
Chains: 2
Atoms: 2,906
Mol. weight: 48.47 kDa
Released: 4 Jul 2012

Explore 4F7G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4F7G contains 16 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	211-224	14
α-helix	232-247	16
α-helix	262-264	3
α-helix	268-273	6
α-helix	276-284	9
α-helix	291-303	13
β-strand	311-318	8	1
α-helix	319	1
β-strand	325-332	8	1
β-strand	336-340	5	1
β-strand	347-352	6	1
α-helix	353-355	3
β-strand	358-361	4	1
β-strand	365-369	5	1
β-strand	372	1	2
β-strand	374	1	2
β-strand	378-381	4	1
α-helix	385-398	14

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	1658-1683	26
α-helix	1688-1691	4
α-helix	1695-1722	28
α-helix	1724-1736	13
α-helix	1738-1751	14
α-helix	1755-1782	28
α-helix	1790-1820	31

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Talin-1	A	protein	222	Mus musculus	P26039 (AlphaFold model)
Talin-1	B	protein	216	Mus musculus	P26039 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4F7G_1 Talin-1 (chains A)
MHHHHHHSSGVDLGTENLYFQSSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQC
QIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLAR
SLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASP
KSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKS

Sequence of entity 2 (B), FASTA

>4F7G_2 Talin-1 (chains B)
MHHHHHHSSGVDLGTENLYFQSKAPGQLECETAIAALNSCLRDLDQASLAAVSQQLAPRE
GISQEALHTQMLTAVQEISHLIEPLASAARAEASQLGHKVSQMAQYFEPLTLAAVGAASK
TLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAVQMMTEAVEDLT
TTLNEAASAAGVVGGMVDSITQAINQLDEGPMGDPE

Primary citation

A novel membrane-dependent on/off switch mechanism of talin FERM domain at sites of cell adhesion. Song, X., Yang, J., Hirbawi, J. et al. Cell Res (2012) 22:1533-1545. DOI 10.1038/cr.2012.97 · PubMed

Other PDB entries of the same protein (UniProt P26039 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9SR0 1.49 Å, Mouse vinculin head domain 1 (VD1) (residues 2-258) with A50I mutation in complex with…
4W8P 1.5 Å, Crystal structure of RIAM TBS1 in complex with talin R7R8 domains
9DZ5 1.74 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
7V1A 1.84 Å, Stapled TBS peptide from RIAM bound to talin R7R8 domains
3DYJ 1.85 Å, Crystal Structure of the R11R12 Domains of Talin
8FSE 1.9 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain
3IVF 1.94 Å, Crystal structure of the talin head FERM domain
3S90 1.97 Å, Human vinculin head domain Vh1 (residues 1-252) in complex with murine talin (VBS33;…
5IC0 1.97 Å, Structural analysis of a talin triple domain module
8FTB 1.97 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
2X0C 2.0 Å, Crystal Structure of the R7R8 domains of Talin
1T01 2.06 Å, Vinculin complexed with the VBS1 helix from talin

Browse structure collections

About this viewer

MolViewer shows 4F7G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.