ZZ Domain of CBP- a Novel Fold for a Protein Interaction Module. Determined by solution NMR. Released 18 Jan 2005.
Explore 1TOT in 3D Show helices and sheets RCSB PDB PDBe
1TOT contains 1 α-helix and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2 | 1 | 1 |
| β-strand | 7-9 | 3 | 1 |
| β-strand | 14-16 | 3 | 1 |
| β-strand | 19-22 | 4 | 2 |
| β-strand | 29-30 | 2 | 2 |
| α-helix | 32-38 | 7 | |
| β-strand | 44-47 | 4 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| CREB-binding protein | A | protein | 52 | Mus musculus | P45481 (AlphaFold model) |
>1TOT_1 CREB-binding protein (chains A) GQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLD
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
ZZ domain of CBP: an unusual zinc finger fold in a protein interaction module. Legge, G.B., Martinez-Yamout, M.A., Hambly, D.M. et al. J Mol Biol (2004) 343:1081-1093. DOI 10.1016/j.jmb.2004.08.087 · PubMed
Other PDB entries of the same protein (UniProt P45481 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1TOT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.