1UGI: Uracil-DNA glycosylase inhibitor protein
Uracil-DNA glycosylase inhibitor protein. Determined by X-ray diffraction at 1.55 Å resolution. Released 25 Mar 1999.
- Method
- X-ray diffraction
- Resolution
- 1.55 Å
- Organism
- Bacillus phage PBS2
- Chains
- 8
- Atoms
- 6,095
- Mol. weight
- 77.68 kDa
- Released
- 25 Mar 1999
Explore 1UGI in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1UGI contains 31 α-helices and 42 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A, C and H: 3 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-12 | 10 | |
| α-helix | 17-21 | 5 | |
| β-strand | 22-24 | 3 | 1 |
| α-helix | 26-33 | 8 | |
| β-strand | 41-48 | 8 | 1 |
| β-strand | 53-60 | 8 | 1 |
| β-strand | 67-73 | 7 | 1 |
| β-strand | 79-83 | 5 | 1 |
Chain B: 4 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-12 | 10 | |
| α-helix | 17-21 | 5 | |
| β-strand | 22-24 | 3 | 1 |
| α-helix | 26-33 | 8 | |
| β-strand | 41-48 | 8 | 1 |
| β-strand | 53-60 | 8 | 1 |
| α-helix | 61 | 1 | |
| β-strand | 67-73 | 7 | 1 |
| β-strand | 79-83 | 5 | 1 |
Chain D: 4 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-12 | 9 | |
| α-helix | 17-21 | 5 | |
| β-strand | 22-24 | 3 | 2 |
| α-helix | 26-33 | 8 | |
| β-strand | 41-48 | 8 | 2 |
| β-strand | 53-60 | 8 | 2 |
| α-helix | 61 | 1 | |
| β-strand | 67-73 | 7 | 2 |
| β-strand | 79-83 | 5 | 2 |
Chain E: 4 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-12 | 10 | |
| α-helix | 17-21 | 5 | |
| β-strand | 22-24 | 3 | 3 |
| α-helix | 26-33 | 8 | |
| β-strand | 41-48 | 8 | 3 |
| α-helix | 49-51 | 3 | |
| β-strand | 53-60 | 8 | 3 |
| β-strand | 67-73 | 7 | 3 |
| β-strand | 79-83 | 5 | 3 |
Chain F: 5 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-12 | 9 | |
| α-helix | 17 | 1 | |
| β-strand | 18 | 1 | 3 |
| α-helix | 19-21 | 3 | |
| β-strand | 22-24 | 3 | 3 |
| α-helix | 26-33 | 8 | |
| β-strand | 41-48 | 8 | 3 |
| β-strand | 53-60 | 8 | 3 |
| α-helix | 61 | 1 | |
| β-strand | 67-73 | 7 | 3 |
| β-strand | 79-83 | 5 | 3 |
Chain G: 5 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-12 | 10 | |
| α-helix | 17 | 1 | |
| β-strand | 18 | 1 | 4 |
| α-helix | 19-21 | 3 | |
| β-strand | 22-24 | 3 | 4 |
| α-helix | 26-33 | 8 | |
| β-strand | 41-48 | 8 | 4 |
| β-strand | 53-60 | 8 | 4 |
| α-helix | 61 | 1 | |
| β-strand | 67-73 | 7 | 4 |
| β-strand | 79-83 | 5 | 4 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Uracil-DNA glycosylase inhibitor | A, B, C, D, E, F, G, H | protein | 84 | Bacillus phage PBS2 | P14739 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA
>1UGI_1 URACIL-DNA GLYCOSYLASE INHIBITOR (chains A, B, C, D, E, F, G, H)
MTNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTS
DAPEYKPWALVIQDSNGENKIKML
Primary citation
Protein mimicry of DNA from crystal structures of the uracil-DNA glycosylase inhibitor protein and its complex with Escherichia coli uracil-DNA glycosylase. Putnam, C.D., Shroyer, M.J., Lundquist, A.J. et al. J Mol Biol (1999) 287:331-346. DOI 10.1006/jmbi.1999.2605 · PubMed
Other PDB entries of the same protein (UniProt P14739 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1UGH 1.9 Å, Crystal structure of human uracil-DNA glycosylase in complex with a protein inhibitor:…
- 4LYL 1.93 Å, Crystal structure of uracil-DNA glycosylase from cod (Gadus morhua) in complex with the…
- 2UGI 2.2 Å, Protein mimicry of DNA from crystal structures of the uracil glycosylase inhibitor…
- 2J8X 2.3 Å, Epstein-Barr virus uracil-DNA glycosylase in complex with Ugi from PBS-2
- 1UUG 2.4 Å, Escherichia coli uracil-DNA glycosylase:inhibitor complex with wild-type udg and…
- 6LYD 2.6 Å, Crystal Structure of mimivirus UNG Y322L in complex with UGI
- 2UUG 2.6 Å, Escherichia coli uracil-DNA glycosylase:inhibitor complex with H187D mutant udg and…
- 1UDI 2.7 Å, Nucleotide mimicry in the crystal structure of the uracil-DNA glycosylase-uracil…
- 1LQG 2.9 Å, Escherichia coli uracil-DNA glycosylase complex with uracil-DNA glycosylase inhibitor…
- 2ZHX 3.1 Å, Crystal structure of Uracil-DNA Glycosylase from Mycobacterium tuberculosis in complex…
- 6LYE 3.1 Å, Crystal Structure of mimivirus UNG Y322F in complex with UGI
- 1EUI 3.2 Å, Escherichia coli uracil-DNA glycosylase complex with uracil-DNA glycosylase inhibitor…
Browse structure collections
About this viewer
MolViewer shows 1UGI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.