Protein mimicry of DNA from crystal structures of the uracil glycosylase inhibitor protein and its complex with escherichia coli uracil-DNA glycosylase. Determined by X-ray diffraction at 2.2 Å resolution. Released 25 Mar 1999.
Explore 2UGI in 3D Show helices and sheets RCSB PDB PDBe
2UGI contains 4 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-12 | 8 | |
| β-strand | 21-24 | 4 | 1 |
| α-helix | 26-33 | 8 | |
| β-strand | 41-48 | 8 | 1 |
| β-strand | 53-60 | 8 | 1 |
| β-strand | 67-73 | 7 | 1 |
| β-strand | 79-83 | 5 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-12 | 9 | |
| β-strand | 22-24 | 3 | 2 |
| α-helix | 26-33 | 8 | |
| β-strand | 41-48 | 8 | 2 |
| β-strand | 53-60 | 8 | 2 |
| β-strand | 67-73 | 7 | 2 |
| β-strand | 79-83 | 5 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Uracil-DNA glycosylase inhibitor | A, B | protein | 84 | Bacillus phage PBS2 | P14739 (AlphaFold model) |
>2UGI_1 URACIL-DNA GLYCOSYLASE INHIBITOR (chains A, B) MTNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTS DAPEYKPWALVIQDSNGENKIKML
Protein mimicry of DNA from crystal structures of the uracil-DNA glycosylase inhibitor protein and its complex with Escherichia coli uracil-DNA glycosylase. Putnam, C.D., Shroyer, M.J., Lundquist, A.J. et al. J Mol Biol (1999) 287:331-346. DOI 10.1006/jmbi.1999.2605 · PubMed
Other PDB entries of the same protein (UniProt P14739 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2UGI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.