1UJK: VHS domain of human GGA1

VHS domain of human GGA1 complexed with C-terminal phosphopeptide from BACE. Determined by X-ray diffraction at 1.9 Å resolution. Released 11 May 2004.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,705
Mol. weight: 37.33 kDa
Released: 11 May 2004

Explore 1UJK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UJK contains 19 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	3-5	3
α-helix	10-17	8
α-helix	27-37	11
α-helix	43-55	13
α-helix	60-74	15
α-helix	79-85	7
α-helix	88-98	11
α-helix	104-106	3
α-helix	109-125	17
α-helix	130-141	12

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	10-17	8
α-helix	27-39	13
α-helix	43-55	13
α-helix	60-76	17
α-helix	79-85	7
α-helix	88-98	11
α-helix	104-106	3
α-helix	109-125	17
α-helix	130-141	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ADP-ribosylation factor binding protein GGA1	A, B	protein	147	Homo sapiens	Q9UJY5 (AlphaFold model)
C-terminal peptide from Beta-secretase	C, D	protein	12		P56817 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1UJK_1 ADP-ribosylation factor binding protein GGA1 (chains A, B)
MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQE
WEAIQALTVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLY
SWTVGLPEEVKIAEAYQMLKKQGIVKS

Sequence of entity 2 (C, D), FASTA

>1UJK_2 C-terminal peptide from Beta-secretase (chains C, D)
HDDFADDISLLK

Primary citation

Insights into the Phosphoregulation of beta-Secretase Sorting Signal by the VHS Domain of GGA1. Shiba, T., Kametaka, S., Kawasaki, M. et al. Traffic (2004) 5:437-448. DOI 10.1111/j.1600-0854.2004.00188.x · PubMed

Other PDB entries of the same protein (UniProt Q9UJY5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1J2J 1.6 Å, Crystal structure of GGA1 GAT N-terminal region in complex with ARF1 GTP form
3G2S 1.7 Å, VHS Domain of human GGA1 complexed with SorLA C-terminal Peptide
1JWG 2.0 Å, VHS Domain of human GGA1 complexed with cation-independent M6PR C-terminal Peptide
3G2T 2.0 Å, VHS Domain of human GGA1 complexed with SorLA C-terminal Phosphopeptide
1JWF 2.1 Å, Crystal Structure of human GGA1 VHS domain.
1O3X 2.1 Å, Crystal structure of human GGA1 GAT domain
3G2V 2.1 Å, VHS Domain of human GGA1 complexed with Sotilin C-terminal Phosphopeptide
1NA8 2.3 Å, Crystal structure of ADP-ribosylation factor binding protein GGA1
2DWY 2.3 Å, Crystal Structure Analysis of GGA1-GAE
3G2U 2.3 Å, VHS Domain of human GGA1 complexed with Sotilin C-terminal Peptide
1NWM 2.4 Å, GAT domain of human GGA1
3G2W 2.4 Å, VHS Domain of human GGA1 complexed with a DXXLL hinge peptide

Browse structure collections

About this viewer

MolViewer shows 1UJK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.