1V05: Filamin C

Dimerization of human Filamin C: crystal structure of the domain 24. Determined by X-ray diffraction at 1.43 Å resolution. Released 17 Nov 2004.

Method: X-ray diffraction
Resolution: 1.43 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 804
Mol. weight: 10.38 kDa
Released: 17 Nov 2004

Explore 1V05 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1V05 contains 4 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	2633	1	1
α-helix	2635-2637	3
β-strand	2639-2641	3	2
α-helix	2643-2645	3
β-strand	2647	1	3
β-strand	2654-2659	6	2
β-strand	2664	1	1
β-strand	2668-2673	6	3
β-strand	2681-2686	6	2
β-strand	2691-2697	7	2
β-strand	2702-2710	9	3
β-strand	2713-2714	2	3
α-helix	2715	1
α-helix	2718	1
β-strand	2720-2724	5	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Filamin C	A	protein	96	HOMO SAPIENS	Q14315 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1V05_1 FILAMIN C (chains A)
AMGSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGN
RVYNVTYTVKEKGDYILIVKWGDESVPGSPFKVKVP

Primary citation

Structural Basis for Vertebrate Filamin Dimerization. Pudas, R., Kiema, T.-R., Butler, P.J.G. et al. Structure (2005) 13:111. DOI 10.1016/J.STR.2004.10.014 · PubMed

Other PDB entries of the same protein (UniProt Q14315 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7OUU 1.47 Å, Crystal structure of human filamin C domains 14-15
7P0E 1.6 Å, Crystal structure of human filamin C domains 14-15 cardiovascular disease causing…
7OUV 1.8 Å, Crystal structure of human filamin C domains 14-15 cardiovascular disease causing…
2NQC 2.05 Å, Crystal structure of ig-like domain 23 from human filamin C
3V8O 2.8 Å, Human Filamin C Ig - like Domains 4 and 5
8PA0 2.85 Å, cvHsp (HspB7) C131S alpha-crystallin domain - filamin C (FLNC) domain 24 complex
4MGX 3.16 Å, Crystal structure of human filamin C domains 4-5 and GPIB alpha cytoplasmic domain complex
2D7M Solution structure of the 14th Filamin domain from human Filamin C
2D7N Solution structure of the 16th Filamin domain from human Filamin C
2D7O Solution structure of the 17th Filamin domain from human Filamin C
2D7P Solution structure of the 22th Filamin domain from human Filamin C
2D7Q Solution structure of the 23th Filamin domain from human Filamin C

Browse structure collections

About this viewer

MolViewer shows 1V05 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.