1WJ6: KIAA0049 protein

Solution structure of RSGI RUH-024, a PB1 domain in human cDNA, KIAA0049. Determined by solution NMR. Released 29 Nov 2004.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 773
Mol. weight: 11.06 kDa
Released: 29 Nov 2004

Explore 1WJ6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1WJ6 contains 2 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	15-21	7	1
β-strand	24-30	7	1
α-helix	38-49	12
β-strand	54	1	2
β-strand	57-59	3	1
β-strand	65-66	2	1
α-helix	71-84	14
β-strand	87-91	5	1
β-strand	94	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
KIAA0049 protein	A	protein	101	Homo sapiens	Q14596 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1WJ6_1 KIAA0049 protein (chains A)
GSSGSSGPHSMEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLD
EENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGSGPSSG

Primary citation

Solution structure of RSGI RUH-024, a PB1 domain in human cDNA, KIAA0049. Hamada, T., Hirota, H., Hayashi, F. et al. To be published.

Other PDB entries of the same protein (UniProt Q14596 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2BKF 1.56 Å, Structure of the PB1 domain of NBR1
2G4S 2.15 Å, Anomalous substructure of NBR1PB1
4OLE 2.52 Å, Crystal structure of a neighbor of BRCA1 gene 1 (NBR1) from Homo sapiens at 2.52 A…
2CP8 Solution structure of the RSGI RUH-046, a UBA domain from human Next to BRCA1 gene 1…
2L8J GABARAPL-1 NBR1-LIR complex structure
2MGW Solution Structure of the UBA Domain of Human NBR1
2MJ5 Structure of the UBA Domain of Human NBR1 in Complex with Ubiquitin

Browse structure collections

About this viewer

MolViewer shows 1WJ6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.