1X32: PDB entry 1X32

Three Dimensional Solution Structure of the Chromo1 domain of cpSRP43. Determined by solution NMR. Released 20 Sept 2005.

Method

Solution NMR

Organism

Arabidopsis thaliana

Chains

1

Atoms

356

Mol. weight

5.05 kDa

Released

20 Sept 2005

Explore 1X32 in 3D Show helices and sheets RCSB PDB PDBe

Molecules and chains

>1X32_1 chloroplast signal recognition particle component (chains A)
GSGEVNKIIGSRTAGEGAMEYLIEWKDGHSPSWVPSSYIAADVVSEY

Primary citation

Three-dimensional solution structures of the chromodomains of cpSRP43. Sivaraja, V., Kumar, T.K., Leena, P.S. et al. J Biol Chem (2005) 280:41465-41471. DOI 10.1074/jbc.M507077200 · PubMed

Related structures

Other PDB entries of the same protein (UniProt O22265 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 3DEO 1.5 Å, Structural basis for specific substrate recognition by the chloroplast signal…
• 3DEP 2.7 Å, Structural basis for specific substrate recognition by the chloroplast signal…
• 5E4X 2.75 Å, Crystal structure of cpSRP43 chromodomain 3
• 5E4W 2.8 Å, Crystal structure of cpSRP43 chromodomains 2 and 3 in complex with the Alb3 tail
• 3UI2 3.18 Å, Crystal structure of the cpSRP54 tail bound to cpSRP43
• 1X3P 3D solution structure of the Chromo-3 domain of cpSRP43
• 1X3Q 3D Solution Structure of the Chromo-2 Domain of cpSRP43
• 2HUG 3D Solution Structure of the Chromo-2 Domain of cpSRP43 complexed with cpSRP54 peptide
• 2N88 Chromodomain 3 (CD3) of cpSRP43

Browse structure collections

About this viewer

MolViewer shows 1X32 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.