3D solution structure of the Chromo-3 domain of cpSRP43. Determined by solution NMR. Released 20 Sept 2005.
Explore 1X3P in 3D Show helices and sheets RCSB PDB PDBe
1X3P contains 1 α-helix and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9 | 1 | 1 |
| β-strand | 20 | 1 | 1 |
| α-helix | 43-46 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| cpSRP43 | A | protein | 54 | Arabidopsis thaliana | O22265 (AlphaFold model) |
>1X3P_1 cpSRP43 (chains A) AVAESVIGKRVGDDGKTIEYLVKWTDMSDATWEPQDNVDSTLVLLYQQQQPMNE
3D Solution Structure of the Chromo-3 domain of cpSRP43. Leena, P.S.T., Kumar, T.K.S., Sivaraja, V. et al. To be published.
Other PDB entries of the same protein (UniProt O22265 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1X3P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.