3UI2: CpSRP54 tail

Crystal structure of the cpSRP54 tail bound to cpSRP43. Determined by X-ray diffraction at 3.18 Å resolution. Released 11 Jan 2012.

Method: X-ray diffraction
Resolution: 3.18 Å
Organism: Arabidopsis thaliana
Chains: 2
Atoms: 1,923
Mol. weight: 28.34 kDa
Released: 11 Jan 2012

Explore 3UI2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UI2 contains 10 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	86-95	10	1
β-strand	99-106	8	1
β-strand	113-116	4	1
α-helix	117-119	3
α-helix	122-136	15
α-helix	141-146	6
β-strand	156	1	2
β-strand	162	1	2
α-helix	163-170	8
α-helix	173-181	9
α-helix	197-203	7
α-helix	207-215	9
α-helix	230-238	9
α-helix	246-266	21
β-strand	267-271	5	3
β-strand	272-279	8	4
β-strand	286-291	6	4
β-strand	297-301	5	4
β-strand	305	1	3
α-helix	307-317	11

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	534-538	5	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Signal recognition particle 43 kDa protein, chloroplastic	A	protein	244	Arabidopsis thaliana	O22265 (AlphaFold model)
Signal recognition particle 54 kDa protein, chloroplastic	B	protein	13	Arabidopsis thaliana	P37107 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3UI2_1 Signal recognition particle 43 kDa protein, chloroplastic (chains A)
GEVNKIIGSRTAGEGAMEYLIEWKDGHSPSWVPSSYIAADVVSEYETPWWTAARKADEQA
LSQLLEDRDVDAVDENGRTALLFVAGLGSDKCVRLLAEAGADLDHRDMRGGLTALHMAAG
YVRPEVVEALVELGADIEVEDERGLTALELAREILKTTPKGNPMQFGRRIGLEKVINVLE
GQVFEYAEVDEIVEKRGKGKDVEYLVRWKDGGDCEWVKGVHVAEDVAKDYEDGLEYAVAE
SVIG

Sequence of entity 2 (B), FASTA

>3UI2_2 Signal recognition particle 54 kDa protein, chloroplastic (chains B)
QKAPPGTARRKRK

Primary citation

Chromodomains read the arginine code of post-translational targeting. Holdermann, I., Meyer, N.H., Round, A. et al. Nat Struct Mol Biol (2012) 19:260-263. DOI 10.1038/nsmb.2196 · PubMed

Other PDB entries of the same protein (UniProt O22265 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3DEO 1.5 Å, Structural basis for specific substrate recognition by the chloroplast signal…
3DEP 2.7 Å, Structural basis for specific substrate recognition by the chloroplast signal…
5E4X 2.75 Å, Crystal structure of cpSRP43 chromodomain 3
5E4W 2.8 Å, Crystal structure of cpSRP43 chromodomains 2 and 3 in complex with the Alb3 tail
1X32 Three Dimensional Solution Structure of the Chromo1 domain of cpSRP43
1X3P 3D solution structure of the Chromo-3 domain of cpSRP43
1X3Q 3D Solution Structure of the Chromo-2 Domain of cpSRP43
2HUG 3D Solution Structure of the Chromo-2 Domain of cpSRP43 complexed with cpSRP54 peptide
2N88 Chromodomain 3 (CD3) of cpSRP43

Browse structure collections

About this viewer

MolViewer shows 3UI2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.