3D Solution Structure of the Chromo-2 Domain of cpSRP43 complexed with cpSRP54 peptide. Determined by solution NMR. Released 18 Sept 2007.
Explore 2HUG in 3D Show helices and sheets RCSB PDB PDBe
2HUG contains 2 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 21 | 1 | 1 |
| β-strand | 26-28 | 3 | 2 |
| β-strand | 35-37 | 3 | 2 |
| β-strand | 42 | 1 | 1 |
| α-helix | 45-49 | 5 | |
| α-helix | 52-55 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Signal recognition particle 43 kDa protein, chloroplast | A | protein | 57 | Arabidopsis thaliana | O22265 (AlphaFold model) |
| Signal recognition particle 54 kDa protein, chloroplast | B | protein | 14 | Arabidopsis thaliana | P37107 (AlphaFold model) |
>2HUG_1 Signal recognition particle 43 kDa protein, chloroplast (chains A) GSQVFEYAEVDEIVEKRGKGKDVEYLVRWKDGGDCEWVKGVHVAEDVAKDYEDGLEY
>2HUG_2 Signal recognition particle 54 kDa protein, chloroplast (chains B) APPGTARRKRKADS
Assembly of chloroplast signal recognition particle involves structural rearrangement in cpSRP43. Kathir, K.M., Rajalingam, D., Sivaraja, V. et al. J Mol Biol (2008) 381:49-60. DOI 10.1016/j.jmb.2008.05.065 · PubMed
Other PDB entries of the same protein (UniProt O22265 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2HUG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.