2HUG: Chromo-2 Domain of cpSRP43

3D Solution Structure of the Chromo-2 Domain of cpSRP43 complexed with cpSRP54 peptide. Determined by solution NMR. Released 18 Sept 2007.

Method: Solution NMR
Organism: Arabidopsis thaliana
Chains: 2
Atoms: 568
Mol. weight: 8.06 kDa
Released: 18 Sept 2007

Explore 2HUG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HUG contains 2 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	21	1	1
β-strand	26-28	3	2
β-strand	35-37	3	2
β-strand	42	1	1
α-helix	45-49	5
α-helix	52-55	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Signal recognition particle 43 kDa protein, chloroplast	A	protein	57	Arabidopsis thaliana	O22265 (AlphaFold model)
Signal recognition particle 54 kDa protein, chloroplast	B	protein	14	Arabidopsis thaliana	P37107 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2HUG_1 Signal recognition particle 43 kDa protein, chloroplast (chains A)
GSQVFEYAEVDEIVEKRGKGKDVEYLVRWKDGGDCEWVKGVHVAEDVAKDYEDGLEY

Sequence of entity 2 (B), FASTA

>2HUG_2 Signal recognition particle 54 kDa protein, chloroplast (chains B)
APPGTARRKRKADS

Primary citation

Assembly of chloroplast signal recognition particle involves structural rearrangement in cpSRP43. Kathir, K.M., Rajalingam, D., Sivaraja, V. et al. J Mol Biol (2008) 381:49-60. DOI 10.1016/j.jmb.2008.05.065 · PubMed

Other PDB entries of the same protein (UniProt O22265 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3DEO 1.5 Å, Structural basis for specific substrate recognition by the chloroplast signal…
3DEP 2.7 Å, Structural basis for specific substrate recognition by the chloroplast signal…
5E4X 2.75 Å, Crystal structure of cpSRP43 chromodomain 3
5E4W 2.8 Å, Crystal structure of cpSRP43 chromodomains 2 and 3 in complex with the Alb3 tail
3UI2 3.18 Å, Crystal structure of the cpSRP54 tail bound to cpSRP43
1X32 Three Dimensional Solution Structure of the Chromo1 domain of cpSRP43
1X3P 3D solution structure of the Chromo-3 domain of cpSRP43
1X3Q 3D Solution Structure of the Chromo-2 Domain of cpSRP43
2N88 Chromodomain 3 (CD3) of cpSRP43

Browse structure collections

About this viewer

MolViewer shows 2HUG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.