5E4X: CpSRP43 chromodomain 3

Crystal structure of cpSRP43 chromodomain 3. Determined by X-ray diffraction at 2.75 Å resolution. Released 2 Dec 2015.

Method: X-ray diffraction
Resolution: 2.75 Å
Organism: Arabidopsis thaliana
Chains: 1
Atoms: 416
Mol. weight: 5.71 kDa
Ligands: MG
Released: 2 Dec 2015

Explore 5E4X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5E4X contains 1 α-helix and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	322-330	9	1
β-strand	337-343	7	1
α-helix	359-367	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Signal recognition particle 43 kDa protein, chloroplastic	A	protein	50	Arabidopsis thaliana	O22265 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5E4X_1 Signal recognition particle 43 kDa protein, chloroplastic (chains A)
YAVAESVIGKRVGDDGKTIEYLVKWTDMSDATWEPQDNVDSTLVLLYQQQ

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Primary citation

Structural basis for cpSRP43 chromodomain selectivity and dynamics in Alb3 insertase interaction. Horn, A., Hennig, J., Ahmed, Y.L. et al. Nat Commun (2015) 6:8875-8875. DOI 10.1038/ncomms9875 · PubMed

Other PDB entries of the same protein (UniProt O22265 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3DEO 1.5 Å, Structural basis for specific substrate recognition by the chloroplast signal…
3DEP 2.7 Å, Structural basis for specific substrate recognition by the chloroplast signal…
5E4W 2.8 Å, Crystal structure of cpSRP43 chromodomains 2 and 3 in complex with the Alb3 tail
3UI2 3.18 Å, Crystal structure of the cpSRP54 tail bound to cpSRP43
1X32 Three Dimensional Solution Structure of the Chromo1 domain of cpSRP43
1X3P 3D solution structure of the Chromo-3 domain of cpSRP43
1X3Q 3D Solution Structure of the Chromo-2 Domain of cpSRP43
2HUG 3D Solution Structure of the Chromo-2 Domain of cpSRP43 complexed with cpSRP54 peptide
2N88 Chromodomain 3 (CD3) of cpSRP43

Browse structure collections

About this viewer

MolViewer shows 5E4X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.