1X6C: PDB entry 1X6C

Solution structures of the SH2 domain of human protein-tyrosine phosphatase SHP-1. Determined by solution NMR. Released 17 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 888
Mol. weight: 12.61 kDa
Released: 17 Nov 2005

Explore 1X6C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1X6C contains 2 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	15-25	11
β-strand	30-35	6	1
β-strand	40	1	2
β-strand	42	1	2
β-strand	43-52	10	1
β-strand	60-67	8	1
β-strand	68-70	3	3
β-strand	73-75	3	3
β-strand	82	1	3
α-helix	85-95	11
β-strand	97-98	2	4
β-strand	104-105	2	4
β-strand	109-110	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase, non-receptor type 6	A	protein	118	Homo sapiens	P29350 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1X6C_1 Tyrosine-protein phosphatase, non-receptor type 6 (chains A)
GSSGSSGWYHGHMSGGQAETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPL
RVTHIKVMCEGGRYTVGGLETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYSGPSSG

Primary citation

Solution structures of the SH2 domain of human protein-tyrosine phosphatase SHP-1. Sato, M., Koshiba, S., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt P29350 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4GRZ 1.37 Å, Crystal structure of SHP1 catalytic domain with PO4
4HJP 1.4 Å, SHP-1 catalytic domain WPD loop open
4GRY 1.7 Å, Crystal structure of SHP1 catalytic domain with SO4
8YHI 1.75 Å, The Crystal Structure of SHP1 from Biortus.
4GS0 1.8 Å, Crystal structure of SHP1 catalytic domain with JAK1 activation loop peptide
4HJQ 1.8 Å, SHP-1 catalytic domain WPD loop closed
1FPR 2.5 Å, Crystal structure of the complex formed between the catalytic domain of shp-1 and an in…
1GWZ 2.5 Å, Crystal structure of the catalytic domain of the protein tyrosine phosphatase shp-1
6SM5 2.75 Å, MbC/SHP1-C-SH2 complex
2B3O 2.8 Å, Crystal structure of human tyrosine phosphatase SHP-1
3PS5 3.1 Å, Crystal structure of the full-length Human Protein Tyrosine Phosphatase SHP-1
2RMX Solution structure of the SHP-1 C-terminal SH2 domain complexed with a…

Browse structure collections

About this viewer

MolViewer shows 1X6C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.