1X79: Human GGA1 GAT domain

Crystal structure of human GGA1 GAT domain complexed with the GAT-binding domain of Rabaptin5. Determined by X-ray diffraction at 2.41 Å resolution. Released 12 Oct 2004.

Method: X-ray diffraction
Resolution: 2.41 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,243
Mol. weight: 37.26 kDa
Ligands: DTT
Released: 12 Oct 2004

Explore 1X79 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1X79 contains 7 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	212-233	22
α-helix	245-258	14
α-helix	260-267	8
α-helix	274-297	24

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	553-639	87

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	555-633	79
α-helix	636-639	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ADP-ribosylation factor binding protein GGA1	A	protein	98	Homo sapiens	Q9UJY5 (AlphaFold model)
Rab GTPase binding effector protein 1	B, C	protein	112	Homo sapiens	Q15276 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1X79_1 ADP-ribosylation factor binding protein GGA1 (chains A)
GPLGSKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLF
RLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGEE

Sequence of entity 2 (B, C), FASTA

>1X79_2 Rab GTPase binding effector protein 1 (chains B, C)
MAETRDQVKKLQLMLRQANDQLEKTMKDKQELEDFIKQSSEDSSHQISALVLRAQASEIL
LEELQQGLSQAKRDVQEQMAVLMQSREQVSEELVRLQKDNDSLQGKHSLHVS

Ligands and cofactors

ID	Name	Formula	Copies
DTT	2,3-dihydroxy-1,4-dithiobutane	C4 H10 O2 S2	2

Water and common crystallization additives (SO4) are not listed.

Primary citation

Crystal structure of human GGA1 GAT domain complexed with the GAT-binding domain of Rabaptin5. Zhu, G., Zhai, P., He, X. et al. EMBO J (2004) 23:3909-3917. DOI 10.1038/sj.emboj.7600411 · PubMed

Other PDB entries of the same protein (UniProt Q9UJY5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1J2J 1.6 Å, Crystal structure of GGA1 GAT N-terminal region in complex with ARF1 GTP form
3G2S 1.7 Å, VHS Domain of human GGA1 complexed with SorLA C-terminal Peptide
1UJK 1.9 Å, VHS domain of human GGA1 complexed with C-terminal phosphopeptide from BACE
1JWG 2.0 Å, VHS Domain of human GGA1 complexed with cation-independent M6PR C-terminal Peptide
3G2T 2.0 Å, VHS Domain of human GGA1 complexed with SorLA C-terminal Phosphopeptide
1JWF 2.1 Å, Crystal Structure of human GGA1 VHS domain.
1O3X 2.1 Å, Crystal structure of human GGA1 GAT domain
3G2V 2.1 Å, VHS Domain of human GGA1 complexed with Sotilin C-terminal Phosphopeptide
1NA8 2.3 Å, Crystal structure of ADP-ribosylation factor binding protein GGA1
2DWY 2.3 Å, Crystal Structure Analysis of GGA1-GAE
3G2U 2.3 Å, VHS Domain of human GGA1 complexed with Sotilin C-terminal Peptide
1NWM 2.4 Å, GAT domain of human GGA1

Browse structure collections

About this viewer

MolViewer shows 1X79 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.