Thyroxine-Thyroid Hormone Receptor Interactions. Determined by X-ray diffraction at 2.5 Å resolution. Released 7 Dec 2004.
Explore 1XZX in 3D Show helices and sheets RCSB PDB PDBe
1XZX contains 14 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 202-207 | 6 | |
| α-helix | 212-215 | 4 | |
| α-helix | 216-232 | 17 | |
| β-strand | 244-245 | 2 | 1 |
| α-helix | 246-247 | 2 | |
| α-helix | 266-288 | 23 | |
| α-helix | 291-294 | 4 | |
| α-helix | 298-318 | 21 | |
| β-strand | 322 | 1 | 2 |
| β-strand | 327 | 1 | 2 |
| β-strand | 328-330 | 3 | 1 |
| β-strand | 334-336 | 3 | 1 |
| α-helix | 338-341 | 4 | |
| α-helix | 342-346 | 5 | |
| α-helix | 348-360 | 13 | |
| α-helix | 367-378 | 12 | |
| α-helix | 389-410 | 22 | |
| α-helix | 417-444 | 28 | |
| α-helix | 453-459 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Thyroid hormone receptor beta-1 | X | protein | 281 | Homo sapiens | P10828 (AlphaFold model) |
>1XZX_1 Thyroid hormone receptor beta-1 (chains X) MGSSHHHHHHSSGLVPRGSHMEELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWK QKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCED QIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSL SSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
Thyroxine-thyroid hormone receptor interactions. Sandler, B., Webb, P., Apriletti, J.W. et al. J Biol Chem (2004) 279:55801-55808. DOI 10.1074/jbc.M410124200 · PubMed
Other PDB entries of the same protein (UniProt P10828 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1XZX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.