1Z5V: Human gamma-tubulin

Crystal structure of human gamma-tubulin bound to GTPgammaS. Determined by X-ray diffraction at 2.71 Å resolution. Released 31 May 2005.

Method: X-ray diffraction
Resolution: 2.71 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,195
Mol. weight: 54.48 kDa
Ligands: GSP, MG
Released: 31 May 2005

Explore 1Z5V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Z5V contains 16 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	1
α-helix	11-28	18
β-strand	52-54	3	2
β-strand	60-62	3	2
β-strand	64-68	5	1
α-helix	71-78	8
α-helix	88-90	3
β-strand	91-93	3	1
α-helix	104-128	25
β-strand	132-140	9	1
α-helix	145-160	16
β-strand	165-172	8	1
α-helix	184-197	14
β-strand	201-206	6	1
α-helix	207-215	9
α-helix	225-238	14
α-helix	241-244	4
α-helix	253-260	8
β-strand	268-269	2	1
β-strand	270-273	4	3
α-helix	290-296	7
α-helix	300-302	3
β-strand	303	1	3
β-strand	317-325	9	3
α-helix	332-342	11
β-strand	348	1	3
β-strand	356-361	6	3
β-strand	374-381	8	3
α-helix	382-384	3
α-helix	385-399	15
α-helix	418-434	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tubulin gamma-1 chain	A	protein	474	Homo sapiens	P23258 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1Z5V_1 Tubulin gamma-1 chain (chains A)
MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEAIVEEFATEGTDRKDVFFYQADDEHY
IPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFD
IIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSD
VVVQPYNSLLTLKRLTQNADCLVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSAST
TTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQP
KNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVAL
SRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDE
MDTSREIVQQLIDEYHAATRPDYISWGTQVDVDGGEQKLISEEDLLLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
GSP	5'-guanosine-diphosphate-monothiophosphate	C10 H16 N5 O13 P3 S	1
MG	Magnesium ion	Mg	1

Primary citation

Insights into microtubule nucleation from the crystal structure of human gamma-tubulin. Aldaz, H., Rice, L.M., Stearns, T. et al. Nature (2005) 435:523-527. DOI 10.1038/nature03586 · PubMed

Other PDB entries of the same protein (UniProt P23258 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CB2 2.3 Å, Crystal structure of human gamma-tubulin bound to GDP
1Z5W 3.0 Å, Crystal Structure of gamma-tubulin bound to GTP
8RX1 3.57 Å, CryoEM structure of the gTuRC-CM1dim complex
9SMX 3.67 Å, CM1-activated gTuRC in complex with nascent alpha-E254D mutant microtubules
8Q62 3.72 Å, Early closed conformation of the g-tubulin ring complex
6V5V 3.8 Å, Structure of gamma-tubulin in the native human gamma-tubulin ring complex
7AS4 4.13 Å, Recombinant human gTuRC
6V6S 4.3 Å, Structure of the native human gamma-tubulin ring complex
8VA2 4.5 Å, Symmetry expanded map of 2 gamma-tubulins bound to 2 alpha tubulins in gamma tubulin…
9H9P 4.5 Å, Spokes 12 and 13 of the human gamma-tubulin ring complex in complex with CDK5RAP2 and…
9QVN 4.7 Å, Cryo-EM reconstruction of the NEDD1 anchor protein bound to the gamma-tubulin ring complex
7QJ0 5.32 Å, Structure of recombinant human gamma-Tubulin Ring Complex 6-spoked assembly intermediate…

Browse structure collections

About this viewer

MolViewer shows 1Z5V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.