3CB2: Human gamma-tubulin

Crystal structure of human gamma-tubulin bound to GDP. Determined by X-ray diffraction at 2.3 Å resolution. Released 10 Jun 2008.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,012
Mol. weight: 108.97 kDa
Ligands: GDP
Released: 10 Jun 2008

Explore 3CB2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3CB2 contains 52 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	5-10	6	1
α-helix	11-28	18
β-strand	31	1	2
α-helix	36	1
β-strand	37	1	2
α-helix	38	1
α-helix	41-42	2
α-helix	48-50	3
β-strand	52-54	3	3
β-strand	60-62	3	3
β-strand	64-68	5	1
α-helix	72-79	8
α-helix	88-90	3
β-strand	91-93	3	1
α-helix	104-127	24
β-strand	134-140	7	1
α-helix	145-149	5
α-helix	150-160	11
β-strand	165-172	8	1
α-helix	173	1
α-helix	184-197	14
β-strand	201-206	6	1
α-helix	207-216	10
α-helix	225-239	15
α-helix	253-260	8
β-strand	268-269	2	1
β-strand	270-274	5	4
α-helix	287-289	3
α-helix	290-296	7
α-helix	300-302	3
β-strand	303	1	4
β-strand	317-325	9	4
α-helix	330-342	13
β-strand	348	1	4
β-strand	356-361	6	4
α-helix	362-364	3
β-strand	374-381	8	4
α-helix	382-384	3
α-helix	385-400	16
α-helix	406-409	4
α-helix	412-414	3
α-helix	419-437	19
α-helix	441-443	3

Chain B: 26 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	5
α-helix	11-28	18
β-strand	31	1	6
β-strand	36	1	7
β-strand	37	1	6
α-helix	38	1
α-helix	39-41	3
β-strand	52-54	3	8
β-strand	59	1	7
β-strand	60-62	3	8
β-strand	64-68	5	5
α-helix	72-78	7
α-helix	88-90	3
β-strand	91-93	3	5
α-helix	104-113	10
α-helix	115-127	13
β-strand	132-140	9	5
α-helix	145-160	16
β-strand	165-172	8	5
α-helix	173-174	2
α-helix	175-180	6
α-helix	184-197	14
β-strand	201-206	6	5
α-helix	207-216	10
α-helix	225-239	15
α-helix	241-244	4
α-helix	249-251	3
α-helix	253-260	8
β-strand	268-269	2	5
β-strand	270-274	5	9
α-helix	290-298	9
α-helix	300-302	3
β-strand	303	1	9
β-strand	317-325	9	9
α-helix	330-332	3
α-helix	333-342	10
β-strand	348	1	9
β-strand	356-361	6	9
β-strand	374-381	8	9
α-helix	382-384	3
α-helix	385-399	15
α-helix	406-409	4
α-helix	412-414	3
α-helix	419-437	19
α-helix	441-443	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
tubulin gamma-1 chain	A, B	protein	475	Homo sapiens	P23258 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3CB2_1 tubulin gamma-1 chain (chains A, B)
MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEAIVEEFATEGTDRKDVFFYQADDEHY
IPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFD
IIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSD
VVVQPYNSLLTLKRLTQNADCLVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSAST
TTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQP
KNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVAL
SRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDE
MDTSREIVQQLIDEYHAATRPDYISWGTQEQVDVDGGQKLISEEDLLLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	2

Primary citation

The lattice as allosteric effector: structural studies of alphabeta- and gamma-tubulin clarify the role of GTP in microtubule assembly. Rice, L.M., Montabana, E.A., Agard, D.A. Proc Natl Acad Sci U S A (2008) 105:5378-5383. DOI 10.1073/pnas.0801155105 · PubMed

Other PDB entries of the same protein (UniProt P23258 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1Z5V 2.71 Å, Crystal structure of human gamma-tubulin bound to GTPgammaS
1Z5W 3.0 Å, Crystal Structure of gamma-tubulin bound to GTP
8RX1 3.57 Å, CryoEM structure of the gTuRC-CM1dim complex
9SMX 3.67 Å, CM1-activated gTuRC in complex with nascent alpha-E254D mutant microtubules
8Q62 3.72 Å, Early closed conformation of the g-tubulin ring complex
6V5V 3.8 Å, Structure of gamma-tubulin in the native human gamma-tubulin ring complex
7AS4 4.13 Å, Recombinant human gTuRC
6V6S 4.3 Å, Structure of the native human gamma-tubulin ring complex
8VA2 4.5 Å, Symmetry expanded map of 2 gamma-tubulins bound to 2 alpha tubulins in gamma tubulin…
9H9P 4.5 Å, Spokes 12 and 13 of the human gamma-tubulin ring complex in complex with CDK5RAP2 and…
9QVN 4.7 Å, Cryo-EM reconstruction of the NEDD1 anchor protein bound to the gamma-tubulin ring complex
7QJ0 5.32 Å, Structure of recombinant human gamma-Tubulin Ring Complex 6-spoked assembly intermediate…

Browse structure collections

About this viewer

MolViewer shows 3CB2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.