1ZOQ: IRF3-CBP complex

IRF3-CBP complex. Determined by X-ray diffraction at 2.37 Å resolution. Released 21 Mar 2006.

Method: X-ray diffraction
Resolution: 2.37 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,138
Mol. weight: 52.85 kDa
Released: 21 Mar 2006

Explore 1ZOQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ZOQ contains 19 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	202-210	9	1
β-strand	213-222	10	1
β-strand	226-229	4	2
β-strand	241-244	4	2
α-helix	245-247	3
α-helix	248-250	3
α-helix	255-266	12
β-strand	272-277	6	2
β-strand	280-285	6	2
β-strand	291-296	6	1
β-strand	309-310	2	1
β-strand	317-321	5	2
α-helix	322-334	13
α-helix	339-341	3
β-strand	343-348	6	1
α-helix	358-360	3
β-strand	364-369	6	1
α-helix	370-381	12

Chain B: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	203-210	8	3
β-strand	213-221	9	3
β-strand	226-229	4	4
β-strand	241-244	4	4
α-helix	245-247	3
α-helix	255-266	12
β-strand	272-277	6	4
β-strand	280-285	6	4
β-strand	291-296	6	3
β-strand	309-310	2	3
β-strand	317-321	5	4
α-helix	322-334	13
α-helix	339-341	3
β-strand	343-348	6	3
α-helix	358-360	3
β-strand	363-369	7	3
α-helix	370-381	12

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	2066-2072	7
α-helix	2080-2091	12
α-helix	2094-2103	10

Chain D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	2066-2072	7
α-helix	2080-2091	12
α-helix	2094-2104	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon regulatory factor 3	A, B	protein	191	Homo sapiens	Q14653 (AlphaFold model)
CREB-binding protein	C, D	protein	47	Homo sapiens	Q92793 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1ZOQ_1 Interferon regulatory factor 3 (chains A, B)
LVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDR
GVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDK
EGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRAL
VEMARVGGASS

Sequence of entity 2 (C, D), FASTA

>1ZOQ_2 CREB-binding protein (chains C, D)
SALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVAN

Primary citation

Crystal structure of IRF-3 in complex with CBP. Qin, B.Y., Liu, C., Srinath, H. et al. Structure (2005) 13:1269-1277. DOI 10.1016/j.str.2005.06.011 · PubMed

Other PDB entries of the same protein (UniProt Q14653 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SJA 1.5 Å, Structure of HPV16 E6 oncoprotein in complex with IRF3 LxxLL motif
5JEL 1.6 Å, Phosphorylated TRIF in complex with IRF-3
7JFL 1.68 Å, Crystal structure of human phosphorylated IRF-3 bound to CBP
5JEO 1.72 Å, Phosphorylated Rotavirus NSP1 in complex with IRF-3
6SIV 1.75 Å, Structure of HPV16 E6 oncoprotein in complex with mutant IRF3 LxxLL motif
3A77 1.8 Å, The crystal structure of phosphorylated IRF-3
5JEJ 2.0 Å, Phosphorylated STING in complex with IRF-3 CTD
1QWT 2.1 Å, Auto-inhibitory interferon regulation factor-3 (IRF3) transactivation domain
1J2F 2.3 Å, X-ray crystal structure of IRF-3 and its functional implications
3QU6 2.3 Å, Crystal structure of IRF-3 DBD free form
2PI0 2.31 Å, Crystal Structure of IRF-3 bound to the PRDIII-I regulatory element of the human…
5JEK 2.4 Å, Phosphorylated MAVS in complex with IRF-3

Browse structure collections

About this viewer

MolViewer shows 1ZOQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.