21EE: Human PHF20L1(1-80)

Crystal structure of human PHF20L1(1-80) in complex with H3K36me. Determined by X-ray diffraction at 1.34 Å resolution. Released 12 Aug 2026.

Method: X-ray diffraction
Resolution: 1.34 Å
Organism: Homo sapiens
Chains: 2
Atoms: 717
Mol. weight: 11.51 kDa
Released: 12 Aug 2026

Explore 21EE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

21EE contains 2 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
β-strand	18-22	5	1
β-strand	28-37	10	1
β-strand	42-47	6	1
α-helix	52-54	3
β-strand	56-59	4	1
β-strand	65-66	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PHD finger protein 20-like protein 1	A	protein	80	Homo sapiens	A8MW92 (AlphaFold model)
Histone H3.1t	B	protein	15	Homo sapiens	Q16695 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>21EE_1 PHD finger protein 20-like protein 1 (chains A)
MSKKPPNRPGITFEIGARLEALDYLQKWYPSRIEKIDYEEGKMLVHFERWSHRYDEWIYW
DSNRLRPLERPALRKEGLKD

Sequence of entity 2 (B), FASTA

>21EE_2 Histone H3.1t (chains B)
SAPATGGVKKPHRYR

Primary citation

A revised model for PHF20L1 Tudor function: DNA binding overrides methylation selectivity on nucleosomes. Huang, X., Xiao, Q., Liu, X. et al. J Biol Chem (2026) 302:113181-113181. DOI 10.1016/j.jbc.2026.113181 · PubMed

Other PDB entries of the same protein (UniProt A8MW92 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6L1P 1.23 Å, Crystal structure of PHF20L1 in complex with Hit 1
6L0X 1.3 Å, The First Tudor Domain of PHF20L1
6L1C 1.58 Å, Crystal Structure Of of PHF20L1 Tudor1 Y24L mutant
6L10 1.6 Å, PHF20L1 Tudor1 - MES
6L1I 1.85 Å, Crystal Structure Of of PHF20L1 Tudor1 Y24W/Y29W mutant
6L1F 1.9 Å, Crystal structure of PHF20L1 Tudor1 in complex with K142me1 DNMT1
21ED 2.31 Å, Crystal structure of human PHF20L1(85-142)
2EQM Solution structure of the TUDOR domain of PHD finger protein 20-like 1 [Homo sapiens]
2EQU Solution structure of the tudor domain of PHD finger protein 20-like 1
2JTF Solution Structure of the PHF20L1 MBT domain

Browse structure collections

About this viewer

MolViewer shows 21EE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.