2EQM: PHD finger protein 20-like 1

Solution structure of the TUDOR domain of PHD finger protein 20-like 1 [Homo sapiens]. Determined by solution NMR. Released 2 Oct 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 742
Mol. weight: 10.52 kDa
Released: 2 Oct 2007

Explore 2EQM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2EQM contains 0 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	25-29	5	1
β-strand	35-44	10	1
β-strand	49-54	6	1
β-strand	61-66	6	1
β-strand	72-73	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PHD finger protein 20-like 1	A	protein	88	Homo sapiens	A8MW92 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2EQM_1 PHD finger protein 20-like 1 (chains A)
GSSGSSGMSKKPPNRPGITFEIGARLEALDYLQKWYPSRIEKIDYEEGKMLVHFERWSHR
YDEWIYWDSNRLRPLERPALRKEGLKDE

Primary citation

Solution structure of the TUDOR domain of PHD finger protein 20-like 1 [Homo sapiens]. Dang, W., Muto, Y., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt A8MW92 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6L1P 1.23 Å, Crystal structure of PHF20L1 in complex with Hit 1
6L0X 1.3 Å, The First Tudor Domain of PHF20L1
21EE 1.34 Å, Crystal structure of human PHF20L1(1-80) in complex with H3K36me
6L1C 1.58 Å, Crystal Structure Of of PHF20L1 Tudor1 Y24L mutant
6L10 1.6 Å, PHF20L1 Tudor1 - MES
6L1I 1.85 Å, Crystal Structure Of of PHF20L1 Tudor1 Y24W/Y29W mutant
6L1F 1.9 Å, Crystal structure of PHF20L1 Tudor1 in complex with K142me1 DNMT1
21ED 2.31 Å, Crystal structure of human PHF20L1(85-142)
2EQU Solution structure of the tudor domain of PHD finger protein 20-like 1
2JTF Solution Structure of the PHF20L1 MBT domain

Browse structure collections

About this viewer

MolViewer shows 2EQM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.