2JTF: PHF20L1 MBT domain

Solution Structure of the PHF20L1 MBT domain. Determined by solution NMR. Released 19 Aug 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 573
Mol. weight: 10.06 kDa
Released: 19 Aug 2008

Explore 2JTF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JTF contains 0 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	1
β-strand	18-23	6	2
β-strand	27-37	11	2
β-strand	42-46	5	2
β-strand	55-59	5	2
β-strand	65-66	2	2
β-strand	67	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PHD finger protein 20-like 1	A	protein	83	Homo sapiens	A8MW92 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JTF_1 PHD finger protein 20-like 1 (chains A)
GSRRASVGSMSKKPPNRPGITFEIGARLEALDYLQKWYPSRIEKIDYEEGKMLVHFERWS
HRYDEWIYWDSNRLRPLERPALR

Primary citation

Structural Analysis of Histone H4K20 Methyllysine Recognition by the MBT Domain of PHF20L1. Brockmann, C., Iberg, A.N., Rehbein, K. et al. To be published.

Other PDB entries of the same protein (UniProt A8MW92 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6L1P 1.23 Å, Crystal structure of PHF20L1 in complex with Hit 1
6L0X 1.3 Å, The First Tudor Domain of PHF20L1
21EE 1.34 Å, Crystal structure of human PHF20L1(1-80) in complex with H3K36me
6L1C 1.58 Å, Crystal Structure Of of PHF20L1 Tudor1 Y24L mutant
6L10 1.6 Å, PHF20L1 Tudor1 - MES
6L1I 1.85 Å, Crystal Structure Of of PHF20L1 Tudor1 Y24W/Y29W mutant
6L1F 1.9 Å, Crystal structure of PHF20L1 Tudor1 in complex with K142me1 DNMT1
21ED 2.31 Å, Crystal structure of human PHF20L1(85-142)
2EQM Solution structure of the TUDOR domain of PHD finger protein 20-like 1 [Homo sapiens]
2EQU Solution structure of the tudor domain of PHD finger protein 20-like 1

Browse structure collections

About this viewer

MolViewer shows 2JTF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.