2EQU: Tudor domain of PHD finger protein 20-like 1

Solution structure of the tudor domain of PHD finger protein 20-like 1. Determined by solution NMR. Released 2 Oct 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 584
Mol. weight: 8.32 kDa
Released: 2 Oct 2007

Explore 2EQU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2EQU contains 3 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	92-96	5	1
β-strand	102-110	9	1
β-strand	116-120	5	1
β-strand	125-128	4	1
α-helix	130-132	3
β-strand	133-134	2	1
α-helix	135-137	3
α-helix	138-140	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PHD finger protein 20-like 1	A	protein	74	Homo sapiens	A8MW92 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2EQU_1 PHD finger protein 20-like 1 (chains A)
GSSGSSGFDFKAGEEVLARWTDCRYYPAKIEAINKEGTFTVQFYDGVIRCLKRMHIKAMP
EDAKGQDWIALVKA

Primary citation

Solution structure of the tudor domain of PHD finger protein 20-like 1. Futami, K., Suzuki, S., Muto, Y. et al. To be published.

Other PDB entries of the same protein (UniProt A8MW92 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6L1P 1.23 Å, Crystal structure of PHF20L1 in complex with Hit 1
6L0X 1.3 Å, The First Tudor Domain of PHF20L1
21EE 1.34 Å, Crystal structure of human PHF20L1(1-80) in complex with H3K36me
6L1C 1.58 Å, Crystal Structure Of of PHF20L1 Tudor1 Y24L mutant
6L10 1.6 Å, PHF20L1 Tudor1 - MES
6L1I 1.85 Å, Crystal Structure Of of PHF20L1 Tudor1 Y24W/Y29W mutant
6L1F 1.9 Å, Crystal structure of PHF20L1 Tudor1 in complex with K142me1 DNMT1
21ED 2.31 Å, Crystal structure of human PHF20L1(85-142)
2EQM Solution structure of the TUDOR domain of PHD finger protein 20-like 1 [Homo sapiens]
2JTF Solution Structure of the PHF20L1 MBT domain

Browse structure collections

About this viewer

MolViewer shows 2EQU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.