25GN: Receptor-arrestin

receptor-arrestin. Determined by electron microscopy at 3.2 Å resolution. Released 26 Aug 2026.

Method: Electron microscopy
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,853
Mol. weight: 131.83 kDa
Released: 26 Aug 2026

Explore 25GN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

25GN contains 23 α-helices and 52 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 8 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	1
β-strand	18-22	5	1
β-strand	26-28	3	2
β-strand	29	1	3
β-strand	34	1	3
α-helix	35-36	2
β-strand	37-43	7	1
β-strand	53-62	10	4
β-strand	80-87	8	4
α-helix	95-98	4
α-helix	99-107	9
β-strand	112-117	6	1
β-strand	127-129	3	4
β-strand	141-149	9	4
α-helix	160-162	3
β-strand	163-168	6	4
β-strand	169-171	3	2
α-helix	180-182	3
β-strand	183-186	4	5
β-strand	198-203	6	5
β-strand	207-208	2	6
β-strand	214-222	9	5
β-strand	228-241	14	7
β-strand	249-257	9	7
β-strand	266-274	9	5
β-strand	288-290	3	4
α-helix	291-292	2
β-strand	300	1	4
α-helix	301-303	3
β-strand	317-329	13	7
β-strand	342-349	8	7
β-strand	350-351	2	6
α-helix	353-356	4

Chain H: 0 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	8
β-strand	10	1	9
β-strand	13-15	3	10
β-strand	20-26	7	9
β-strand	28	1	8
β-strand	35-42	8	10
β-strand	48-55	8	10
β-strand	60-63	4	10
β-strand	71-76	6	9
β-strand	81-87	7	9
β-strand	95-103	9	10
β-strand	112	1	10
β-strand	117-121	5	10

Chain L: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	11
β-strand	13	1	12
β-strand	20-23	4	13
β-strand	26	1	11
β-strand	34-39	6	14
β-strand	46-50	5	14
β-strand	54-55	2	14
α-helix	56	1
β-strand	63-67	5	13
β-strand	72-76	5	13
β-strand	86-91	6	14
α-helix	97	1
β-strand	98-99	2	14
β-strand	103-104	2	14
β-strand	106	1	12

Chain R: 13 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	194-222	29
α-helix	232-254	23
α-helix	283-311	29
α-helix	317-319	3
α-helix	324-331	8
α-helix	334-344	11
α-helix	373-396	24
α-helix	408-412	5
α-helix	413-451	39
α-helix	475-485	11
α-helix	486-489	4
α-helix	490-494	5
α-helix	497-499	3
β-strand	532-535	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 1B of Beta-arrestin-1	C	protein	410	Homo sapiens	P49407 (AlphaFold model)
heavy chain of scFv30	H	protein	121	Homo sapiens
light chain of scFv30	L	protein	108	Homo sapiens
Frizzled-6	R	protein	524	Homo sapiens	O60353 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>25GN_1 Isoform 1B of Beta-arrestin-1 (chains C)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTVA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPSSVTLQPGPEDTGKALGVDYEVKAFVAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
IVLFNTAQYKVPVAMEEADDTVAPSSTFSKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRSSDVAVELPFTLMHPKPKEEPPHREVPEN
ETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR

Sequence of entity 2 (H), FASTA

>25GN_2 heavy chain of scFv30 (chains H)
MQVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGYTY
YADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVTVS
S

Sequence of entity 3 (L), FASTA

>25GN_3 light chain of scFv30 (chains L)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIK

Sequence of entity 4 (R), FASTA

>25GN_4 Frizzled-6 (chains R)
HSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLC
KAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFD
PHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQCAPPCPNMYFKSDELEFA
KSFIGTVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVCYSIVSLMYFIGFLLGDST
ACNKADEKLELGDTVVLGSQNKACTVLFMLLYFFTMAGTVWWVILTITWFLAAGRKWSCE
AIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEGDNISGVCFVGLYDLDASRYFVLLPLCLC
VFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVFSGLYLVPLVTLLGCYVYE
QVNRITWEITWVSDHCRQYHIPCPYQAKAKARPELALFMIKYLMTLIVGISAVFWVGSKK
TCTEWAGFFKRNRKRDPISESRRVLQEDESCTTASSSLAKDTSS

Primary citation

Direct beta-arrestin engagement by the non-canonical WNT receptor FZD6 via a shallow binding pocket. Zhang, Z.B., Lin, X., Li, M.R. et al. Acta Pharmacol Sin (2026). DOI 10.1038/s41401-026-01902-w · PubMed

Other PDB entries of the same protein (UniProt P49407 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8AS4 2.3 Å, Crystal structure of human beta-arrestin-1
9ZZO 2.6 Å, MP1104-bound Kappa Opioid Receptor in complex with beta-arrestin1
8ZYT 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
8ZYU 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
2IV8 2.8 Å, beta appendage in complex with b-arrestin peptide
8ZYY 2.83 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
9UYN 2.9 Å, Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to beta-arrestin 1 in…
27EM 3.0 Å, Cryo_EM structure of PACAP27_PAC1R_Beta_arrestin 1 complex
9LXR 3.07 Å, A Cryo-EM structure of LA-PTH-PTH1R-Beta-arrestin1 complex (state 1 conformation)
9LY2 3.1 Å, A Cryo-EM structure of LA-PTH-PTH1R-V2RT-Beta-arrestin1 complex (state 1 conformation)
9MBA 3.14 Å, Cryo-EM structure of complex of transducer-bound GPCR
8AS2 3.2 Å, Structure of arrestin2 in complex with 4P CCR5 phosphopeptide and Fab30

Browse structure collections

About this viewer

MolViewer shows 25GN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.