2A79: Voltage-gated potassium channel beta-2 subunit

Mammalian Shaker Kv1.2 potassium channel- beta subunit complex. Determined by X-ray diffraction at 2.9 Å resolution. Released 12 Jul 2005.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Rattus norvegicus
Chains: 4
Atoms: 4,997
Mol. weight: 101.33 kDa
Ligands: NAP
Released: 12 Jul 2005

Explore 2A79 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2A79 contains 44 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	39-41	3	1
β-strand	48-50	3	1
β-strand	52-55	4	2
α-helix	59-63	5
α-helix	66-78	13
β-strand	83-87	5	2
α-helix	90-93	4
α-helix	94-105	12
α-helix	110-112	3
β-strand	114-119	6	2
β-strand	121	1	3
α-helix	126-128	3
β-strand	129	1	3
α-helix	133-147	15
β-strand	152-157	6	2
α-helix	166-178	13
β-strand	182-188	7	2
α-helix	192-205	14
α-helix	208-210	3
β-strand	212-214	3	2
β-strand	216	1	4
β-strand	218	1	5
β-strand	221	1	5
α-helix	223	1
α-helix	224-228	5
α-helix	229-236	8
β-strand	239-242	4	2
β-strand	243	1	4
α-helix	247-252	6
α-helix	264-266	3
α-helix	271-277	7
α-helix	280-298	19
α-helix	303-312	10
β-strand	317-322	6	2
α-helix	327-334	8
α-helix	336-339	4
α-helix	340-342	3
α-helix	345-355	11
α-helix	358-360	3

Chain B: 16 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	34-39	6	6
β-strand	42-47	6	6
α-helix	48-52	5
α-helix	62-65	4
α-helix	66-68	3
β-strand	69-70	2	6
β-strand	75-78	4	6
α-helix	82-93	12
α-helix	99-101	3
α-helix	106-115	10
α-helix	120-130	11
α-helix	220-242	23
α-helix	291-299	9
α-helix	302-309	8
α-helix	312-323	12
α-helix	325-345	21
α-helix	347-350	4
α-helix	362-372	11
α-helix	385-402	18
α-helix	405-420	16

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	4-19	16
α-helix	23-30	8
α-helix	34-51	18

Chain D: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-13	12
α-helix	15-18	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Voltage-gated potassium channel beta-2 subunit	A	protein	333	Rattus norvegicus	P62483 (AlphaFold model)
Potassium voltage-gated channel subfamily A member 2	B	protein	499	Rattus norvegicus	P63142 (AlphaFold model)
poly-unknown chain	C	protein	52	Rattus norvegicus
poly-unknown chain	D	protein	21	Rattus norvegicus

Sequence of entity 1 (A), FASTA

>2A79_1 Voltage-gated potassium channel beta-2 subunit (chains A)
MLQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGK
AEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDV
VFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQ
AEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLK
DKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENI
GAIQVLPKLSSSIVHEIDSILGNKPYSKKDYRS

Sequence of entity 2 (B), FASTA

>2A79_2 Potassium voltage-gated channel subfamily A member 2 (chains B)
MTVATGDPVDEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLG
DPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGE
EAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSF
CLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVR
FFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVR
VFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPS
IPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE
TEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTA
NCTLANTNYVNITKMLTDV

Sequence of entity 3 (C), FASTA

>2A79_3 poly-unknown chain (chains C)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Sequence of entity 4 (D), FASTA

>2A79_4 poly-unknown chain (chains D)
XXXXXXXXXXXXXXXXXXXXX

Ligands and cofactors

ID	Name	Formula	Copies
NAP	NADP nicotinamide-adenine-dinucleotide phosphate	C21 H28 N7 O17 P3	1

Water and common crystallization additives (K) are not listed.

Primary citation

Crystal structure of a mammalian voltage-dependent Shaker family K+ channel. Long, S.B., Campbell, E.B., Mackinnon, R. Science (2005) 309:897-903. DOI 10.1126/science.1116269 · PubMed

Other PDB entries of the same protein (UniProt P62483 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3EAU 1.82 Å, Voltage-dependent K+ channel beta subunit in complex with cortisone
3EB3 2.0 Å, Voltage-dependent K+ channel beta subunit (W121A) in complex with cortisone
3EB4 2.0 Å, Voltage-dependent K+ channel beta subunit (I211R) in complex with cortisone
1EXB 2.1 Å, Structure of the cytoplasmic beta subunit-T1 assembly of voltage-dependent K channels
2R9R 2.4 Å, Shaker family voltage dependent potassium channel (kv1.2-kv2.1 paddle chimera channel)…
4JTA 2.5 Å, Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin
4JTD 2.54 Å, Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Lys27Met mutant of…
4JTC 2.56 Å, Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin in Cs+
1QRQ 2.8 Å, Structure of a voltage-dependent K+ channel beta subunit
3LNM 2.9 Å, F233W mutant of the Kv2.1 paddle-Kv1.2 chimera channel
3LUT 2.9 Å, A Structural Model for the Full-length Shaker Potassium Channel Kv1.2
6EBL 3.0 Å, The voltage-activated Kv1.2-2.1 paddle chimera channel in lipid nanodiscs, cytosolic…

Browse more

2A79 is part of these collections:

Ion channels

About this viewer

MolViewer shows 2A79 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.