2BKF: PB1 domain of NBR1

Structure of the PB1 domain of NBR1. Determined by X-ray diffraction at 1.56 Å resolution. Released 18 Jan 2006.

Method: X-ray diffraction
Resolution: 1.56 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 816
Mol. weight: 10.06 kDa
Released: 18 Jan 2006

Explore 2BKF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2BKF contains 3 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	5-11	7	1
β-strand	14-20	7	1
α-helix	23-25	3
α-helix	28-39	12
β-strand	44-49	6	1
β-strand	55-58	4	1
α-helix	61-73	13
β-strand	77-84	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Zinc-finger protein NBR1 (next to breast cancer 1)	A	protein	87	HOMO SAPIENS	Q14596 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2BKF_1 ZINC-FINGER PROTEIN NBR1 (NEXT TO BREAST CANCER 1) (chains A)
GAMEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSI
NSQGEYEEALKMAVKQGNQLQMQVHEG

Primary citation

Crystal Structure of the Pb1 Domain of Nbr1. Mueller, S., Kursula, I., Zou, P. et al. FEBS Lett (2006) 580:341. DOI 10.1016/J.FEBSLET.2005.12.021 · PubMed

Other PDB entries of the same protein (UniProt Q14596 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2G4S 2.15 Å, Anomalous substructure of NBR1PB1
4OLE 2.52 Å, Crystal structure of a neighbor of BRCA1 gene 1 (NBR1) from Homo sapiens at 2.52 A…
1WJ6 Solution structure of RSGI RUH-024, a PB1 domain in human cDNA, KIAA0049
2CP8 Solution structure of the RSGI RUH-046, a UBA domain from human Next to BRCA1 gene 1…
2L8J GABARAPL-1 NBR1-LIR complex structure
2MGW Solution Structure of the UBA Domain of Human NBR1
2MJ5 Structure of the UBA Domain of Human NBR1 in Complex with Ubiquitin

Browse structure collections

About this viewer

MolViewer shows 2BKF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.