2BZE: Human RTF1 PLUS3 domain

NMR Structure of human RTF1 PLUS3 domain. Determined by solution NMR. Released 3 Jan 2007.

Method: Solution NMR
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,231
Mol. weight: 17.57 kDa
Released: 3 Jan 2007

Explore 2BZE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2BZE contains 7 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	-1	1	1
α-helix	348-353	6
β-strand	355-356	2	2
α-helix	358-364	7
α-helix	371-374	4
β-strand	375	1	3
β-strand	377	1	3
β-strand	378-382	5	2
β-strand	392-409	18	2
β-strand	412-421	10	2
β-strand	426-429	4	2
α-helix	431-433	3
β-strand	434	1	2
α-helix	441-454	14
α-helix	456-459	4
β-strand	460	1	1
α-helix	461-474	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
KIAA0252 protein	A	protein	153	HOMO SAPIENS	Q92541 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2BZE_1 KIAA0252 PROTEIN (chains A)
MGSSHHHHHHSSGLVPRGSHMVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGI
GNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESE
FMKWKEAMFSAGMQLPTLDEINKKELSIKEALN

Primary citation

Structure and DNA Binding of the Human Rtf1 Plus3 Domain. De Jong, R.N., Truffault, V., Diercks, T. et al. Structure (2008) 16:149. DOI 10.1016/J.STR.2007.10.018 · PubMed

Other PDB entries of the same protein (UniProt Q92541 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3U1U 1.8 Å, Crystal structure of RNA polymerase-associated protein RTF1 homolog Plus-3 domain
4L1P 2.12 Å, Crystal Structure of Human Rtf1 Plus3 domain
4L1U 2.42 Å, Crystal Structure of Human Rtf1 Plus3 Domain in Complex with Spt5 CTR Phosphopeptide
9EGX 2.9 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-hexasome, bp +27
9EGY 2.9 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-nucleosome, bp +27
9EGZ 2.9 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-SETD2-nucleosome, bp +27
7UNC 3.0 Å, Pol II-DSIF-SPT6-PAF1c-TFIIS complex with rewrapped nucleosome
7UND 3.0 Å, Pol II-DSIF-SPT6-PAF1c-TFIIS-nucleosome complex (stalled at +38)
6TED 3.1 Å, Structure of complete, activated transcription complex Pol II-DSIF-PAF-SPT6 uncovers…
9EH1 3.1 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-SETD2-nucleosome, 20 bp upstream
9EH2 3.1 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-SETD2-FACT nucleosome upstream
8A3Y 3.3 Å, Structure of mammalian Pol II-DSIF-SPT6-PAF1-TFIIS-hexasome elongation complex

Browse structure collections

About this viewer

MolViewer shows 2BZE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.