Solution structure of the CAP-Gly domain in human Dynactin 1. Determined by solution NMR. Released 19 Nov 2005.
Explore 2COY in 3D Show helices and sheets RCSB PDB PDBe
2COY contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 39-42 | 4 | 1 |
| β-strand | 48-55 | 8 | 1 |
| β-strand | 64-69 | 6 | 1 |
| β-strand | 76 | 1 | 1 |
| β-strand | 79-80 | 2 | 2 |
| β-strand | 83-84 | 2 | 2 |
| β-strand | 93-96 | 4 | 1 |
| α-helix | 98-100 | 3 | |
| β-strand | 101-103 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Dynactin-1 | A | protein | 112 | Homo sapiens | Q14203 (AlphaFold model) |
>2COY_1 Dynactin-1 (chains A) GSSGSSGMAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFA TGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDSGPSSG
Solution structure of the CAP-Gly domain in human Dynactin 1. Saito, K., Koshiba, S., Inoue, M. et al. To be published.
Other PDB entries of the same protein (UniProt Q14203 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2COY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.