2D7N: 16th Filamin domain from human Filamin C

Solution structure of the 16th Filamin domain from human Filamin C. Determined by solution NMR. Released 24 May 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 694
Mol. weight: 9.88 kDa
Released: 24 May 2006

Explore 2D7N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2D7N contains 1 α-helix and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	1
β-strand	11-15	5	2
β-strand	24-29	6	3
β-strand	35-36	2	3
β-strand	39-42	4	2
β-strand	48-52	5	2
β-strand	58-66	9	3
β-strand	76-80	5	3
β-strand	82	1	1
α-helix	83-84	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Filamin-C	A	protein	93	Homo sapiens	Q14315 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2D7N_1 Filamin-C (chains A)
GSSGSSGLRPFNLVIPFAVQKGELTGEVRMPSGKTARPNITDNKDGTITVRYAPTEKGLH
QMGIKYDGNHIPGSPLQFYVDAINSRHSGPSSG

Primary citation

Solution structure of the 16th Filamin domain from human Filamin C. Tomizawa, T., Kigawa, T., Koshiba, S. et al. To be published.

Other PDB entries of the same protein (UniProt Q14315 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1V05 1.43 Å, Dimerization of human Filamin C: crystal structure of the domain 24
7OUU 1.47 Å, Crystal structure of human filamin C domains 14-15
7P0E 1.6 Å, Crystal structure of human filamin C domains 14-15 cardiovascular disease causing…
7OUV 1.8 Å, Crystal structure of human filamin C domains 14-15 cardiovascular disease causing…
2NQC 2.05 Å, Crystal structure of ig-like domain 23 from human filamin C
3V8O 2.8 Å, Human Filamin C Ig - like Domains 4 and 5
8PA0 2.85 Å, cvHsp (HspB7) C131S alpha-crystallin domain - filamin C (FLNC) domain 24 complex
4MGX 3.16 Å, Crystal structure of human filamin C domains 4-5 and GPIB alpha cytoplasmic domain complex
2D7M Solution structure of the 14th Filamin domain from human Filamin C
2D7O Solution structure of the 17th Filamin domain from human Filamin C
2D7P Solution structure of the 22th Filamin domain from human Filamin C
2D7Q Solution structure of the 23th Filamin domain from human Filamin C

Browse structure collections

About this viewer

MolViewer shows 2D7N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.