2DB9: Plus-3 domain of human KIAA0252 protein

Solution structure of the plus-3 domain of human KIAA0252 protein. Determined by solution NMR. Released 15 Jun 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,169
Mol. weight: 16.66 kDa
Released: 15 Jun 2006

Explore 2DB9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DB9 contains 5 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	13	1	1
α-helix	17-22	6
β-strand	24	1	2
α-helix	27-33	7
α-helix	39-43	5
β-strand	47-53	7	2
β-strand	60-65	6	2
β-strand	68-78	11	3
β-strand	81-88	8	3
β-strand	90-91	2	4
β-strand	94-95	2	4
β-strand	98	1	3
β-strand	104	1	2
α-helix	110-123	14
β-strand	129	1	1
α-helix	130-143	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Paf1/RNA polymerase II complex component	A	protein	149	Homo sapiens	Q92541 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DB9_1 Paf1/RNA polymerase II complex component (chains A)
GSSGSSGPPKSQPVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPV
YRVAEITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAM
FSAGMQLPTLDEINKKELSIKEASGPSSG

Primary citation

Solution structure of the plus-3 domain of human KIAA0252 protein. Yoneyama, M., Kigawa, T., Tochio, N. et al. To be published.

Other PDB entries of the same protein (UniProt Q92541 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3U1U 1.8 Å, Crystal structure of RNA polymerase-associated protein RTF1 homolog Plus-3 domain
4L1P 2.12 Å, Crystal Structure of Human Rtf1 Plus3 domain
4L1U 2.42 Å, Crystal Structure of Human Rtf1 Plus3 Domain in Complex with Spt5 CTR Phosphopeptide
9EGX 2.9 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-hexasome, bp +27
9EGY 2.9 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-nucleosome, bp +27
9EGZ 2.9 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-SETD2-nucleosome, bp +27
7UNC 3.0 Å, Pol II-DSIF-SPT6-PAF1c-TFIIS complex with rewrapped nucleosome
7UND 3.0 Å, Pol II-DSIF-SPT6-PAF1c-TFIIS-nucleosome complex (stalled at +38)
6TED 3.1 Å, Structure of complete, activated transcription complex Pol II-DSIF-PAF-SPT6 uncovers…
9EH1 3.1 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-SETD2-nucleosome, 20 bp upstream
9EH2 3.1 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-SETD2-FACT nucleosome upstream
8A3Y 3.3 Å, Structure of mammalian Pol II-DSIF-SPT6-PAF1-TFIIS-hexasome elongation complex

Browse structure collections

About this viewer

MolViewer shows 2DB9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.