2DIT: HIV TAT specific factor 1 variant

Solution structure of the RRM_1 domain of HIV TAT specific factor 1 variant. Determined by solution NMR. Released 30 Sept 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 883
Mol. weight: 12.59 kDa
Released: 30 Sept 2006

Explore 2DIT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DIT contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	17-21	5	1
α-helix	28-31	4
α-helix	34-46	13
α-helix	47-49	3
β-strand	55-59	5	1
β-strand	66-70	5	1
α-helix	74-83	10
β-strand	88-89	2	2
β-strand	92-93	2	2
β-strand	95-98	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
HIV TAT specific factor 1 variant	A	protein	112	Homo sapiens	O43719 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DIT_1 HIV TAT specific factor 1 variant (chains A)
GSSGSSGGPSRMRHERVVIIKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQIRKLLLFD
RHPDGVASVSFRDPEEADYCIQTLDGRWFGGRQITAQAWDGTTDYQSGPSSG

Primary citation

Solution structure of the RRM_1 domain of HIV TAT specific factor 1 variant. Dang, W., Muto, Y., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt O43719 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6N3D 1.13 Å, Structure of HIV Tat-specific factor 1 U2AF Homology Motif (APO-State)
6N3E 1.89 Å, Structure of HIV Tat-specific factor 1 U2AF Homology Motif bound to U2AF ligand motif 4
6NSX 2.0 Å, Yeast Hsh155 Ligand bound to Human Tat-SF1 Motif
6N3F 2.1 Å, Structure of HIV Tat-specific factor 1 U2AF Homology Motif bound to SF3b1 ULM5
7Q3L 2.21 Å, Human 17S U2 snRNP 5' domain
7EVO 2.5 Å, The cryo-EM structure of the human 17S U2 snRNP
8HK1 2.7 Å, The cryo-EM structure of human pre-17S U2 snRNP
6Y50 4.1 Å, 5'domain of human 17S U2 snRNP
6Y53 7.1 Å, human 17S U2 snRNP low resolution part
6Y5Q 7.1 Å, human 17S U2 snRNP

Browse structure collections

About this viewer

MolViewer shows 2DIT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.