6N3D: HIV Tat-specific factor 1 U2AF Homology Motif

Structure of HIV Tat-specific factor 1 U2AF Homology Motif (APO-State). Determined by X-ray diffraction at 1.13 Å resolution. Released 2 Jan 2019.

Method: X-ray diffraction
Resolution: 1.13 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,031
Mol. weight: 11.58 kDa
Ligands: MG
Released: 2 Jan 2019

Explore 6N3D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6N3D contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	261-264	4
β-strand	265-269	5	1
α-helix	274-277	4
α-helix	282-295	14
β-strand	301-306	6	1
β-strand	315-319	5	1
α-helix	322-332	11
β-strand	336-337	2	2
β-strand	340-341	2	2
β-strand	343-346	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
HIV Tat-specific factor 1	A	protein	96	Homo sapiens	O43719 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6N3D_1 HIV Tat-specific factor 1 (chains A)
GSMRHERVVIIKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQIRKLLLFDRHPDGVASV
SFRDPEEADYCIQTLDGRWFGGRQITAQAWDGTTDY

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Water and common crystallization additives (CL, PEG, GOL) are not listed.

Primary citation

The pre-mRNA splicing and transcription factor Tat-SF1 is a functional partner of the spliceosome SF3b1 subunit via a U2AF homology motif interface. Loerch, S., Leach, J.R., Horner, S.W. et al. J Biol Chem (2019) 294:2892-2902. DOI 10.1074/jbc.RA118.006764 · PubMed

Other PDB entries of the same protein (UniProt O43719 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6N3E 1.89 Å, Structure of HIV Tat-specific factor 1 U2AF Homology Motif bound to U2AF ligand motif 4
6NSX 2.0 Å, Yeast Hsh155 Ligand bound to Human Tat-SF1 Motif
6N3F 2.1 Å, Structure of HIV Tat-specific factor 1 U2AF Homology Motif bound to SF3b1 ULM5
7Q3L 2.21 Å, Human 17S U2 snRNP 5' domain
7EVO 2.5 Å, The cryo-EM structure of the human 17S U2 snRNP
8HK1 2.7 Å, The cryo-EM structure of human pre-17S U2 snRNP
6Y50 4.1 Å, 5'domain of human 17S U2 snRNP
6Y53 7.1 Å, human 17S U2 snRNP low resolution part
6Y5Q 7.1 Å, human 17S U2 snRNP
2DIT Solution structure of the RRM_1 domain of HIV TAT specific factor 1 variant

Browse structure collections

About this viewer

MolViewer shows 6N3D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.