6NSX: Yeast Hsh155 Ligand

Yeast Hsh155 Ligand bound to Human Tat-SF1 Motif. Determined by X-ray diffraction at 2.0 Å resolution. Released 5 Jun 2019.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Homo sapiens, Saccharomyces cerevisiae
Chains: 2
Atoms: 915
Mol. weight: 11.94 kDa
Released: 5 Jun 2019

Explore 6NSX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6NSX contains 3 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	265-269	5	1
α-helix	274-277	4
α-helix	283-295	13
β-strand	301-307	7	1
β-strand	314-319	6	1
α-helix	322-332	11
β-strand	336-337	2	2
β-strand	340-341	2	2
β-strand	343-346	4	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	101	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
HIV Tat-specific factor 1	A	protein	94	Homo sapiens	O43719 (AlphaFold model)
Hsh155	B	protein	6	Saccharomyces cerevisiae

Sequence of entity 1 (A), FASTA

>6NSX_1 HIV Tat-specific factor 1 (chains A)
MRHERVVIIKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQIRKLLLFDRHPDGVASVSF
RDPEEADYCIQTLDGRWFGGRQITAQAWDGTTDY

Sequence of entity 2 (B), FASTA

>6NSX_2 Hsh155 (chains B)
SRWDVK

Primary citation

Cus2 enforces the first ATP-dependent step of splicing by binding to yeast SF3b1 through a UHM-ULM interaction. Talkish, J., Igel, H., Hunter, O. et al. RNA (2019) 25:1020-1037. DOI 10.1261/rna.070649.119 · PubMed

Other PDB entries of the same protein (UniProt O43719 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6N3D 1.13 Å, Structure of HIV Tat-specific factor 1 U2AF Homology Motif (APO-State)
6N3E 1.89 Å, Structure of HIV Tat-specific factor 1 U2AF Homology Motif bound to U2AF ligand motif 4
6N3F 2.1 Å, Structure of HIV Tat-specific factor 1 U2AF Homology Motif bound to SF3b1 ULM5
7Q3L 2.21 Å, Human 17S U2 snRNP 5' domain
7EVO 2.5 Å, The cryo-EM structure of the human 17S U2 snRNP
8HK1 2.7 Å, The cryo-EM structure of human pre-17S U2 snRNP
6Y50 4.1 Å, 5'domain of human 17S U2 snRNP
6Y53 7.1 Å, human 17S U2 snRNP low resolution part
6Y5Q 7.1 Å, human 17S U2 snRNP
2DIT Solution structure of the RRM_1 domain of HIV TAT specific factor 1 variant

Browse structure collections

About this viewer

MolViewer shows 6NSX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.