2EC4: UAS domain from human FAS-associated factor 1

Solution structure of the UAS domain from human FAS-associated factor 1. Determined by solution NMR. Released 4 Mar 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,374
Mol. weight: 20.13 kDa
Released: 4 Mar 2008

Explore 2EC4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2EC4 contains 7 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	13-28	16
α-helix	40-45	6
β-strand	57-63	7	1
α-helix	69-76	8
α-helix	81-89	9
β-strand	91-97	7	1
α-helix	101-114	14
α-helix	117-125	9
β-strand	133-137	5	1
β-strand	146-150	5	1
α-helix	156-173	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
FAS-associated factor 1	A	protein	178	Homo sapiens	Q9UNN5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2EC4_1 FAS-associated factor 1 (chains A)
GSSGSSGENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLLAI
YLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVVA
QTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFTAQQQEDI

Primary citation

Solution structure of the UAS domain from human FAS-associated factor 1. Zhang, H.P., Hayashi, F., Yokoyama, S. To be published.

Other PDB entries of the same protein (UniProt Q9UNN5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7FGN 1.2 Å, The crystal structure of the FAF1 UBL1
3QX1 1.6 Å, Crystal structure of FAF1 UBX domain
3E21 1.73 Å, Crystal structure of FAF-1 UBA Domain
3QQ8 2.0 Å, Crystal structure of p97-N in complex with FAF1-UBX
3QWZ 2.0 Å, Crystal structure of FAF1 UBX-p97N-domain complex
3QC8 2.2 Å, Crystal Structure of FAF1 UBX Domain In Complex with p97/VCP N Domain Reveals The…
7FGM 2.2 Å, The complex crystals structure of the FAF1 UBL1_L-Hsp70 NBD with ADP and phosphate
3QCA 2.9 Å, Crystal Structure of FAF1 UBX Domain In Complex with p97/VCP N Domain Reveals The…
3R3M 3.0 Å, Crystal structure of the FAF1 UBX domain
8KG2 3.1 Å, Crystal structure of p97-N/D1 hexamer in complex with FAF1-UBX domain
9YW2 3.27 Å, Complex structure of human p97 bound to Faf1 and Ufd1 (NTD focused)
11TA 3.58 Å, Cryo-EM structure of substrate engaged p97-Ufd1-NPL4-Faf1 complex (motor focused)

Browse structure collections

About this viewer

MolViewer shows 2EC4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.