2FXM: Human beta-myosin S2 fragment

Structure of the human beta-myosin S2 fragment. Determined by X-ray diffraction at 2.7 Å resolution. Released 21 Nov 2006.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,955
Mol. weight: 30.61 kDa
Ligands: HG
Released: 21 Nov 2006

Explore 2FXM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FXM contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	840-962	123

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	852-960	109

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin heavy chain, cardiac muscle beta isoform	A, B	protein	129	Homo sapiens	P12883 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2FXM_1 Myosin heavy chain, cardiac muscle beta isoform (chains A, B)
GSSPLLKSAEREKEMASMKEEFTRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAE
QDNLADAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKRDI
DDLELTLAK

Ligands and cofactors

ID	Name	Formula	Copies
HG	Mercury (II) ion	Hg	2

Primary citation

Crystal structures of human cardiac {beta}-myosin II S2-{Delta} provide insight into the functional role of the S2 subfragment. Blankenfeldt, W., Thoma, N.H., Wray, J.S. et al. Proc Natl Acad Sci U S A (2006) 103:17713-17717. DOI 10.1073/pnas.0606741103 · PubMed

Other PDB entries of the same protein (UniProt P12883 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CJ1 2.1 Å, Crystal structure of the coiled coil of MYH7 residues 1526 to 1571 fused to Gp7
6PF2 2.17 Å, Crystal Structure of Amino Acids 1220-1276 of Human Beta Cardiac Myosin Fused to Gp7 and…
6PFP 2.2 Å, Crystal Structure of Amino Acids 1473-1536 of Human Beta Cardiac Myosin Fused to Gp7 and…
4PA0 2.25 Å, Omecamtiv Mercarbil binding site on the Human Beta-Cardiac Myosin Motor Domain
5CHX 2.3 Å, Crystal Structure of amino acids 1590-1657 of MYH7
5CJ0 2.3 Å, Crystal Structure of Amino Acids 1631-1692 of MYH7
5WME 2.3 Å, Crystal Structure of Amino Acids 1729-1786 of Human Beta Cardiac Myosin Fused to Gp7 as…
4XA4 2.33 Å, Crystal Structure of the coiled-coil surrounding Skip 3 of MYH7
9HTF 2.48 Å, Beta-cardiac myosin Y115H mutant motor domain in the pre-powerstroke state, MgADP.VO4 form
2FXO 2.5 Å, Structure of the human beta-myosin S2 fragment
5WJ7 2.5 Å, Crystal Structure of Amino Acids 1733-1797 of Human Beta Cardiac Myosin Fused to Xrcc4
4XA3 2.55 Å, Crystal structure of the coiled-coil surrounding Skip 2 of MYH7

Browse structure collections

About this viewer

MolViewer shows 2FXM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.