2G35: Talin-PTB

NMR structure of talin-PTB in complex with PIPKI. Determined by solution NMR. Released 2 May 2006.

Method: Solution NMR
Organism: Mus musculus
Chains: 2
Atoms: 888
Mol. weight: 12.63 kDa
Released: 2 May 2006

Explore 2G35 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2G35 contains 2 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	6	1
β-strand	7-13	7	1
β-strand	22-28	7	1
β-strand	32-37	6	1
β-strand	43-48	6	1
β-strand	54-57	4	1
β-strand	61-65	5	1
β-strand	74-77	4	1
α-helix	81-99	19

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Talin-1	A	protein	100	Mus musculus	P26039 (AlphaFold model)
peptide	B	protein	8		O60331 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2G35_1 Talin-1 (chains A)
LKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPK
SFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKK

Sequence of entity 2 (B), FASTA

>2G35_2 peptide (chains B)
SWVYSPLH

Primary citation

Structural Basis for the Phosphorylation-regulated Focal Adhesion Targeting of Type Igamma Phosphatidylinositol Phosphate Kinase (PIPKIgamma) by Talin. Kong, X., Wang, X., Misra, S. et al. J Mol Biol (2006) 359:47-54. DOI 10.1016/j.jmb.2006.02.048 · PubMed

Other PDB entries of the same protein (UniProt P26039 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9SR0 1.49 Å, Mouse vinculin head domain 1 (VD1) (residues 2-258) with A50I mutation in complex with…
4W8P 1.5 Å, Crystal structure of RIAM TBS1 in complex with talin R7R8 domains
9DZ5 1.74 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
7V1A 1.84 Å, Stapled TBS peptide from RIAM bound to talin R7R8 domains
3DYJ 1.85 Å, Crystal Structure of the R11R12 Domains of Talin
8FSE 1.9 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain
3IVF 1.94 Å, Crystal structure of the talin head FERM domain
3S90 1.97 Å, Human vinculin head domain Vh1 (residues 1-252) in complex with murine talin (VBS33;…
5IC0 1.97 Å, Structural analysis of a talin triple domain module
8FTB 1.97 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
2X0C 2.0 Å, Crystal Structure of the R7R8 domains of Talin
4F7G 2.05 Å, Crystal structure of talin autoinhibition complex

Browse structure collections

About this viewer

MolViewer shows 2G35 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.