2JPS: NAB2 N-terminal domain

NAB2 N-terminal domain. Determined by solution NMR. Released 18 Mar 2008.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 804
Mol. weight: 11.46 kDa
Released: 18 Mar 2008

Explore 2JPS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JPS contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	4-20	17
α-helix	29-41	13
α-helix	45-55	11
α-helix	61-80	20
α-helix	85-98	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear polyadenylated RNA-binding protein NAB2	A	protein	105	Saccharomyces cerevisiae	P32505 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JPS_1 Nuclear polyadenylated RNA-binding protein NAB2 (chains A)
MSQEQYTENLKVIVAEKLAGIPNFNEDIKYVAEYIVLLIVNGGTVESVVDELASLFDSVS
RDTLANVVQTAFFALEALQQGESAENIVSKIRMMNAQSLGQSDIA

Primary citation

Structure of the N-terminal Mlp1-binding domain of the Saccharomyces cerevisiae mRNA-binding protein, Nab2. Grant, R.P., Marshall, N.J., Yang, J.C. et al. J Mol Biol (2008) 376:1048-1059. DOI 10.1016/j.jmb.2007.11.087 · PubMed

Other PDB entries of the same protein (UniProt P32505 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5L2L 1.55 Å, Nab2 Zn fingers 5-7 bound to A11G RNA
2V75 1.8 Å, N-terminal domain of Nab2
3LCN 2.0 Å, Nab2:Gfd1 complex
4JLQ 3.05 Å, Crystal structure of human Karyopherin-beta2 bound to the PY-NLS of Saccharomyces…
2LHN RNA-binding zinc finger protein
3ZJ1 Structure of Nab2p tandem zinc finger 12
3ZJ2 Structure of Nab2p tandem zinc finger 34

Browse structure collections

About this viewer

MolViewer shows 2JPS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.