2K9U: Filamin-migfilin complex

Solution NMR structure of the Filamin-migfilin complex. Determined by solution NMR. Released 23 Dec 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,064
Mol. weight: 15.1 kDa
Released: 23 Dec 2008

Explore 2K9U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2K9U contains 1 α-helix and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	22-24	3	1
β-strand	31-32	2	2
β-strand	36-42	7	1
β-strand	49-56	8	2
β-strand	62-66	5	1
β-strand	72-78	7	1
β-strand	83-91	9	2
β-strand	95	1	2
α-helix	99	1
β-strand	101-106	6	2

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	10-17	8	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma filamin	A	protein	119	Homo sapiens	Q14315 (AlphaFold model)
Filamin-binding LIM protein 1	B	protein	24		Q8WUP2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2K9U_1 Gamma filamin (chains A)
GIPEFFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSK
AEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVPVASLSDDARRLTVTS

Sequence of entity 2 (B), FASTA

>2K9U_2 Filamin-binding LIM protein 1 (chains B)
MASKPEKRVASSVFITLAPPRRDV

Primary citation

Migfilin, a molecular switch in regulation of integrin activation. Ithychanda, S.S., Das, M., Ma, Y.Q. et al. J Biol Chem (2009) 284:4713-4722. DOI 10.1074/jbc.M807719200 · PubMed

Other PDB entries of the same protein (UniProt Q14315 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1V05 1.43 Å, Dimerization of human Filamin C: crystal structure of the domain 24
7OUU 1.47 Å, Crystal structure of human filamin C domains 14-15
7P0E 1.6 Å, Crystal structure of human filamin C domains 14-15 cardiovascular disease causing…
7OUV 1.8 Å, Crystal structure of human filamin C domains 14-15 cardiovascular disease causing…
2NQC 2.05 Å, Crystal structure of ig-like domain 23 from human filamin C
3V8O 2.8 Å, Human Filamin C Ig - like Domains 4 and 5
8PA0 2.85 Å, cvHsp (HspB7) C131S alpha-crystallin domain - filamin C (FLNC) domain 24 complex
4MGX 3.16 Å, Crystal structure of human filamin C domains 4-5 and GPIB alpha cytoplasmic domain complex
2D7M Solution structure of the 14th Filamin domain from human Filamin C
2D7N Solution structure of the 16th Filamin domain from human Filamin C
2D7O Solution structure of the 17th Filamin domain from human Filamin C
2D7P Solution structure of the 22th Filamin domain from human Filamin C

Browse structure collections

About this viewer

MolViewer shows 2K9U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.