2LOZ: Tensin-like C1 domain-containing phosphatase

The novel binding mode of DLC1 and Tensin2 PTB domain. Determined by solution NMR. Released 6 Jun 2012.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,235
Mol. weight: 17.54 kDa
Released: 6 Jun 2012

Explore 2LOZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LOZ contains 3 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	1267-1270	4
β-strand	1275-1285	11	1
α-helix	1291-1304	14
β-strand	1312-1319	8	1
β-strand	1322-1326	5	1
β-strand	1338-1339	2	1
β-strand	1343-1347	5	1
β-strand	1354-1356	3	2
β-strand	1362-1364	3	2
β-strand	1365-1372	8	1
β-strand	1375-1385	11	1
α-helix	1393-1404	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tensin-like C1 domain-containing phosphatase	A	protein	147	Homo sapiens	Q63HR2 (AlphaFold model)
Rho GTPase-activating protein 7	B	protein	14	Homo sapiens	Q96QB1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LOZ_1 Tensin-like C1 domain-containing phosphatase (chains A)
MSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSAQG
ITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKIFGFVAKKPGSPWENVCH
LFAELDPDQPAGAIVTFITKVLLGQRK

Sequence of entity 2 (B), FASTA

>2LOZ_2 Rho GTPase-activating protein 7 (chains B)
EDHKPGTFPKALTN

Primary citation

Solution structure of the phosphotyrosine binding (PTB) domain of human tensin2 protein in complex with deleted in liver cancer 1 (DLC1) peptide reveals a novel peptide binding mode. Chen, L., Liu, C., Ko, F.C. et al. J Biol Chem (2012) 287:26104-26114. DOI 10.1074/jbc.M112.360206 · PubMed

Other PDB entries of the same protein (UniProt Q63HR2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3HQC 1.8 Å, Crystal structure of Phosphotyrosine-binding domain from the Human Tensin-like C1…
2DKQ Solution structure of the PTB domain of KIAA1075 protein from human
2KNO NMR Solution Structure of SH2 Domain of the Human Tensin Like C1 Domain Containing…
2L6K Solution Structure of a Nonphosphorylated Peptide Recognizing Domain

Browse structure collections

About this viewer

MolViewer shows 2LOZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.