NMR structure of FOXO3a transactivation domains (CR2C-CR3) in complex with CBP KIX domain (2b3l conformation). Determined by solution NMR. Released 16 May 2012.
Explore 2LQH in 3D Show helices and sheets RCSB PDB PDBe
2LQH contains 9 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-9 | 5 | |
| α-helix | 12-26 | 15 | |
| α-helix | 32-36 | 5 | |
| α-helix | 38-57 | 20 | |
| α-helix | 61-81 | 21 | |
| α-helix | 82-86 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 109-115 | 7 | |
| α-helix | 116-121 | 6 | |
| α-helix | 141-150 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| CREB-binding protein | A | protein | 87 | Mus musculus | P45481 (AlphaFold model) |
| Forkhead box O3 | B | protein | 52 | Homo sapiens | O43524 (AlphaFold model) |
>2LQH_1 CREB-binding protein (chains A) GVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANS RDEYYHLLAEKIYKIQKELEEKRRSRL
>2LQH_2 Forkhead box O3 (chains B) GSMSHYGNQTLQDLLTSDSLSHSDGGGSGGGSGGGSLECDMESIIRSELMDA
Structures of KIX domain of CBP in complex with two FOXO3a transactivation domains reveal promiscuity and plasticity in coactivator recruitment. Wang, F., Marshall, C.B., Yamamoto, K. et al. Proc Natl Acad Sci U S A (2012) 109:6078-6083. DOI 10.1073/pnas.1119073109 · PubMed
Other PDB entries of the same protein (UniProt P45481 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2LQH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.