6JRP: CIC-HMG-ETV5-DNA complex

Crystal structure of CIC-HMG-ETV5-DNA complex. Determined by X-ray diffraction at 3.0 Å resolution. Released 31 Jul 2019.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 12
Atoms: 4,360
Mol. weight: 66.33 kDa
Released: 31 Jul 2019

Explore 6JRP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6JRP contains 16 α-helices and 2 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	201-204	4
α-helix	206-221	16
α-helix	227-239	13
α-helix	243-263	21
β-strand	271	1	1

Chain D: 5 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	200-204	5
α-helix	206-221	16
α-helix	229-239	11
α-helix	243-258	16
α-helix	260-263	4
β-strand	269	1	1

Chain G: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	206-221	16
α-helix	227-239	13
α-helix	243-258	16

Chain J: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	201-204	4
α-helix	206-221	16
α-helix	229-239	11
α-helix	243-258	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein capicua homolog	A, D, G, J	protein	80	Homo sapiens	Q96RK0 (AlphaFold model)
DNA (5'-d(aptpgpapaptpgpapapap*a)-3')	B, E, H, K	DNA	11	Homo sapiens
DNA (5'-d(tptptptpcpaptptpcpap*t)-3')	C, F, I, L	DNA	11	Homo sapiens

Sequence of entity 1 (A, D, G, J), FASTA

>6JRP_1 Protein capicua homolog (chains A, D, G, J)
GSHIRRPMNAFMIFSKRHRALVHQRHPNQDNRTVSKILGEWWYALGPKEKQKYHDLAFQV
KEAHFKAHPDWKWCNKDRKK

Sequence of entity 2 (B, E, H, K), FASTA

>6JRP_2 DNA (5'-D(*AP*TP*GP*AP*AP*TP*GP*AP*AP*AP*A)-3') (chains B, E, H, K)
ATGAATGAAAA

Sequence of entity 3 (C, F, I, L), FASTA

>6JRP_3 DNA (5'-D(*TP*TP*TP*TP*CP*AP*TP*TP*CP*AP*T)-3') (chains C, F, I, L)
TTTTCATTCAT

Primary citation

The crystal structure of Capicua HMG-box domain complexed with the ETV5-DNA and its implications for Capicua-mediated cancers. Lee, H., Song, J.J. FEBS J (2019) 286:4951-4963. DOI 10.1111/febs.15008 · PubMed

Other PDB entries of the same protein (UniProt Q96RK0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KZG 2.0 Å, 14-3-3 protein in Complex with CIC S301 phosphorylated peptide
4J2J 2.5 Å, Crystal structure of AXH domain complex with Capicua
6KZH 2.65 Å, 14-3-3 protein in Complex with CIC S173 phosphorylated peptide
7M5W 2.95 Å, Crystal structure of the HMG-C1 domain of human capicua bound to DNA
4J2L 3.15 Å, Crystal Structure of AXH domain complexed with Capicua
2M41 Solution Structure of the AXH domain of Ataxin-1 in complex with ligand peptide from…

Browse structure collections

About this viewer

MolViewer shows 6JRP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.