2MGW: UBA Domain of Human NBR1

Solution Structure of the UBA Domain of Human NBR1. Determined by solution NMR. Released 9 Apr 2014.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 413
Mol. weight: 5.92 kDa
Released: 9 Apr 2014

Explore 2MGW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MGW contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	915-925	11
α-helix	932-942	11
α-helix	946-956	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Next to BRCA1 gene 1 protein	A	protein	52	Homo sapiens	Q14596 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MGW_1 Next to BRCA1 gene 1 protein (chains A)
GPLGSSEDQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNN

Primary citation

Solution structure of the ubiquitin-associated (UBA) domain of human autophagy receptor NBR1 and its interaction with ubiquitin and polyubiquitin. Walinda, E., Morimoto, D., Sugase, K. et al. J Biol Chem (2014) 289:13890-13902. DOI 10.1074/jbc.M114.555441 · PubMed

Other PDB entries of the same protein (UniProt Q14596 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2BKF 1.56 Å, Structure of the PB1 domain of NBR1
2G4S 2.15 Å, Anomalous substructure of NBR1PB1
4OLE 2.52 Å, Crystal structure of a neighbor of BRCA1 gene 1 (NBR1) from Homo sapiens at 2.52 A…
1WJ6 Solution structure of RSGI RUH-024, a PB1 domain in human cDNA, KIAA0049
2CP8 Solution structure of the RSGI RUH-046, a UBA domain from human Next to BRCA1 gene 1…
2L8J GABARAPL-1 NBR1-LIR complex structure
2MJ5 Structure of the UBA Domain of Human NBR1 in Complex with Ubiquitin

Browse structure collections

About this viewer

MolViewer shows 2MGW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.