2MJ9: Designed Exendin-4 analogues
Designed Exendin-4 analogues. Determined by solution NMR. Released 4 Jun 2014.
- Method
- Solution NMR
- Organism
- Heloderma suspectum
- Chains
- 1
- Atoms
- 303
- Mol. weight
- 4.31 kDa
- Released
- 4 Jun 2014
Explore 2MJ9 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
2MJ9 contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 15-27 | 13 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Exendin-4 | A | protein | 39 | Heloderma suspectum | P26349 (AlphaFold model) |
Sequence of entity 1 (A), FASTA
>2MJ9_1 Exendin-4 (chains A)
HGEGTFTSDLSKQMEEEAVRLYIQWLKEGGPSSGRPPPS
Primary citation
Rational design of alpha-helix-stabilized exendin-4 analogues. Rovo, P., Farkas, V., Straner, P. et al. Biochemistry (2014) 53:3540-3552. DOI 10.1021/bi500033c · PubMed
Other PDB entries of the same protein (UniProt P26349 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5OTT 1.92 Å, Extracellular domain of GLP-1 receptor in complex with exendin-4 variant Gly2Hcs/Thr5Hcs
- 3C5T 2.1 Å, Crystal structure of the ligand-bound glucagon-like peptide-1 receptor extracellular…
- 3C59 2.3 Å, Crystal structure of the ligand-bound glucagon-like peptide-1 receptor extracellular…
- 7LLL 3.7 Å, Exendin-4-bound Glucagon-Like Peptide-1 (GLP-1) Receptor in complex with Gs protein
- 1JRJ Solution structure of exendin-4 in 30-vol% trifluoroethanol
- 2NAV NMR solution structure of Ex-4[1-16]/pl14a
- 2NAW NMR solution structure of Exendin-4/conotoxin chimera (Ex-4[1-27]/pl14a)
- 5NIQ exendin-4 variant with dual GLP-1 / glucagon receptor activity
- 6GDZ exendin-4 based dual GLP-1/glucagon receptor agonist
- 6GE2 exendin-4 based dual GLP-1/glucagon receptor agonist
- 7MLL Solution structure of Exenatide (exendin-4) in 30-vol% trifluoroethanol using CS-Rosetta
- 9G0M Trp-cage fortified Tc5b-Exenatide chimera (Ex4-Tc5bER) at 288K
Browse structure collections
About this viewer
MolViewer shows 2MJ9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.