NMR solution structure of a C-terminal domain of the chromodomain helicase DNA-binding protein 1. Determined by solution NMR. Released 1 Jun 2016.
Explore 2N39 in 3D Show helices and sheets RCSB PDB PDBe
2N39 contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-17 | 10 | |
| α-helix | 22-29 | 8 | |
| α-helix | 37-60 | 24 | |
| α-helix | 65-81 | 17 | |
| α-helix | 87-101 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Chromodomain-helicase-DNA-binding protein 1 | A | protein | 108 | Homo sapiens | O14646 (AlphaFold model) |
>2N39_1 Chromodomain-helicase-DNA-binding protein 1 (chains A) GPLGSLDQKTFSICKERMRPVKAALKQLDRPEKGLSEREQLEHTRQCLIKIGDHITECLK EYTNPEQIKQWRKNLWIFVSKFTEFDARKLHKLYKHAIKKRQESQQNS
The Chromatin Remodelling Protein CHD1 Contains a Previously Unrecognised C-Terminal Helical Domain. Mohanty, B., Helder, S., Silva, A.P. et al. J Mol Biol (2016) 428:4298-4314. DOI 10.1016/j.jmb.2016.08.028 · PubMed
Other PDB entries of the same protein (UniProt O14646 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2N39 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.