2N73: ACBD3:PI4KB complex

Solution structure of the ACBD3:PI4KB complex. Determined by solution NMR. Released 20 Jul 2016.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,142
Mol. weight: 16.3 kDa
Released: 20 Jul 2016

Explore 2N73 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2N73 contains 4 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-26	24
α-helix	31-65	35

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	121-122	2
α-helix	157-175	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Golgi resident protein GCP60	A	protein	69	Homo sapiens	Q9H3P7 (AlphaFold model)
Phosphatidylinositol 4-kinase beta	B	protein	80	Homo sapiens	Q9UBF8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2N73_1 Golgi resident protein GCP60 (chains A)
MQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQ
QQAALQKQQ

Sequence of entity 2 (B), FASTA

>2N73_2 Phosphatidylinositol 4-kinase beta (chains B)
GAMVEARSLAVAMGDTVVEPAPLKPTSEPTSGPPGNNGGSLLSVITEGVGELSVIDPEVA
QKACQEVLEKVKLLHGGVAV

Primary citation

Structural insights and in vitro reconstitution of membrane targeting and activation of human PI4KB by the ACBD3 protein. Klima, M., Toth, D.J., Hexnerova, R. et al. Sci Rep (2016) 6:23641-23641. DOI 10.1038/srep23641 · PubMed

Other PDB entries of the same protein (UniProt Q9H3P7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5LZ1 2.0 Å, Crystal structure of human ACBD3 GOLD domain
6HLN 2.1 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of enterovirus-D68
6HMV 2.24 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of…
6HM8 2.28 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of…
5TDQ 2.49 Å, Crystal Structure of the GOLD domain of ACBD3
6HLV 2.5 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of poliovirus-1…
5LZ6 2.6 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of Aichivirus B
6HLW 2.73 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of…
6HLT 2.81 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of rhinovirus-14…
5LZ3 3.0 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of Aichivirus A
2N72 Solution structure of the Q domain from ACBD3

Browse structure collections

About this viewer

MolViewer shows 2N73 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.