Crystal structure of human ACBD3 GOLD domain. Determined by X-ray diffraction at 2.0 Å resolution. Released 14 Dec 2016.
Explore 5LZ1 in 3D Show helices and sheets RCSB PDB PDBe
5LZ1 contains 5 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 365-368 | 4 | |
| α-helix | 370-372 | 3 | |
| β-strand | 373-377 | 5 | 1 |
| α-helix | 380-387 | 8 | |
| α-helix | 391-393 | 3 | |
| β-strand | 394-397 | 4 | 1 |
| β-strand | 402-408 | 7 | 2 |
| α-helix | 409-410 | 2 | |
| β-strand | 415-421 | 7 | 1 |
| β-strand | 427-434 | 8 | 2 |
| β-strand | 444-447 | 4 | 2 |
| β-strand | 476-485 | 10 | 2 |
| β-strand | 491-497 | 7 | 1 |
| β-strand | 503-509 | 7 | 2 |
| β-strand | 518-527 | 10 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Golgi resident protein GCP60 | A | protein | 168 | Homo sapiens | Q9H3P7 (AlphaFold model) |
>5LZ1_1 Golgi resident protein GCP60 (chains A) GAMESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEF ATDNYDIGFGVYFEWTDSPNTAVSVHVSESSDDDEEEEENIGCEEKAKKNANKPLLDEIV PVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR
Kobuviral Non-structural 3A Proteins Act as Molecular Harnesses to Hijack the Host ACBD3 Protein. Klima, M., Chalupska, D., Rozycki, B. et al. Structure (2017) 25:219-230. DOI 10.1016/j.str.2016.11.021 · PubMed
Other PDB entries of the same protein (UniProt Q9H3P7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5LZ1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.