6HM8: Human ACBD3 GOLD domain

Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of enterovirus-D68 (fusion protein). Determined by X-ray diffraction at 2.28 Å resolution. Released 24 Jul 2019.

Method: X-ray diffraction
Resolution: 2.28 Å
Organisms: Homo sapiens, Enterovirus D68
Chains: 2
Atoms: 1,401
Mol. weight: 24.9 kDa
Released: 24 Jul 2019

Explore 6HM8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6HM8 contains 8 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	366-372	7
β-strand	373-377	5	1
α-helix	380-388	9
α-helix	391-393	3
β-strand	394-397	4	1
β-strand	402-408	7	2
α-helix	409-410	2
β-strand	415-422	8	1
β-strand	427-435	9	2
β-strand	476-485	10	2
β-strand	491-497	7	1
β-strand	502-509	8	2
β-strand	518-527	10	1

Chain B: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	19-29	11
α-helix	32-40	9
β-strand	44-46	3	1
α-helix	47-48	2
α-helix	49-51	3
β-strand	53-57	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Golgi resident protein GCP60	A	protein	168	Homo sapiens	Q9H3P7 (AlphaFold model)
Genome polyprotein	B	protein	50	Enterovirus D68	A0A2K9Y515

Sequence of entity 1 (A), FASTA

>6HM8_1 Golgi resident protein GCP60 (chains A)
GAMESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEF
ATDNYDIGFGVYFEWTDSPNTAVSVHVSESSDDDEEEEENIGCEEKAKKNANKPLLDEIV
PVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR

Sequence of entity 2 (B), FASTA

>6HM8_2 Genome polyprotein (chains B)
GSGSGTPAPDAINDLLRSVDSQEVRDYCQKKGWIVIHPSNELVVEKHISR

Primary citation

Convergent evolution in the mechanisms of ACBD3 recruitment to picornavirus replication sites. Horova, V., Lyoo, H., Rozycki, B. et al. PLoS Pathog (2019) 15:e1007962-e1007962. DOI 10.1371/journal.ppat.1007962 · PubMed

Other PDB entries of the same protein (UniProt Q9H3P7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5LZ1 2.0 Å, Crystal structure of human ACBD3 GOLD domain
6HLN 2.1 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of enterovirus-D68
6HMV 2.24 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of…
5TDQ 2.49 Å, Crystal Structure of the GOLD domain of ACBD3
6HLV 2.5 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of poliovirus-1…
5LZ6 2.6 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of Aichivirus B
6HLW 2.73 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of…
6HLT 2.81 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of rhinovirus-14…
5LZ3 3.0 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of Aichivirus A
2N72 Solution structure of the Q domain from ACBD3
2N73 Solution structure of the ACBD3:PI4KB complex

Browse structure collections

About this viewer

MolViewer shows 6HM8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.