6HLT: Human ACBD3 GOLD domain

Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of rhinovirus-14 (HRV14). Determined by X-ray diffraction at 2.81 Å resolution. Released 24 Jul 2019.

Method: X-ray diffraction
Resolution: 2.81 Å
Organisms: Homo sapiens, Human rhinovirus 14
Chains: 4
Atoms: 2,748
Mol. weight: 52.09 kDa
Released: 24 Jul 2019

Explore 6HLT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6HLT contains 10 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	367-372	6
β-strand	373-377	5	1
α-helix	380-390	11
β-strand	394-397	4	1
β-strand	402-408	7	2
α-helix	409-410	2
β-strand	415-422	8	1
β-strand	427-435	9	2
β-strand	476-485	10	2
β-strand	491-497	7	1
β-strand	502-509	8	2
β-strand	518-527	10	1

Chain B: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	17-26	10
α-helix	30-38	9
β-strand	42-44	3	1
β-strand	50-53	4	2

Chain C: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	370-372	3
β-strand	373-377	5	3
α-helix	381-388	8
β-strand	395-397	3	3
β-strand	402-408	7	4
α-helix	409-410	2
β-strand	415-422	8	3
β-strand	427-435	9	4
β-strand	476-485	10	4
β-strand	491-497	7	3
β-strand	502-509	8	4
β-strand	518-527	10	3

Chain D: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	17-26	10
α-helix	30-38	9
β-strand	42-44	3	3
β-strand	49-53	5	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Golgi resident protein GCP60	A, C	protein	166	Homo sapiens	Q9H3P7 (AlphaFold model)
Genome polyprotein	B, D	protein	59	Human rhinovirus 14	P03303 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>6HLT_1 Golgi resident protein GCP60 (chains A, C)
MESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEFAT
DNYDIGFGVYFEWTDSPNTAVSVHVSESSDDDEEEEENIGCEEKAKKNANKPLLDEIVPV
YRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR

Sequence of entity 2 (B, D), FASTA

>6HLT_2 Genome polyprotein (chains B, D)
GAMGPVYKDLEIDVCNTPPPECINDLLKSVDSEEIREYCKKKKWIIPEIPTNIERAMNQ

Primary citation

Convergent evolution in the mechanisms of ACBD3 recruitment to picornavirus replication sites. Horova, V., Lyoo, H., Rozycki, B. et al. PLoS Pathog (2019) 15:e1007962-e1007962. DOI 10.1371/journal.ppat.1007962 · PubMed

Other PDB entries of the same protein (UniProt Q9H3P7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5LZ1 2.0 Å, Crystal structure of human ACBD3 GOLD domain
6HLN 2.1 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of enterovirus-D68
6HMV 2.24 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of…
6HM8 2.28 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of…
5TDQ 2.49 Å, Crystal Structure of the GOLD domain of ACBD3
6HLV 2.5 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of poliovirus-1…
5LZ6 2.6 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of Aichivirus B
6HLW 2.73 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of…
5LZ3 3.0 Å, Crystal structure of human ACBD3 GOLD domain in complex with 3A protein of Aichivirus A
2N72 Solution structure of the Q domain from ACBD3
2N73 Solution structure of the ACBD3:PI4KB complex

Browse structure collections

About this viewer

MolViewer shows 6HLT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.