2NQC: Ig-like domain 23 from human filamin C

Crystal structure of ig-like domain 23 from human filamin C. Determined by X-ray diffraction at 2.05 Å resolution. Released 11 Sept 2007.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Homo sapiens
Chains: 1
Atoms: 768
Mol. weight: 14.3 kDa
Ligands: NI
Released: 11 Sept 2007

Explore 2NQC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2NQC contains 6 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	2485-2487	3
β-strand	2489-2491	3	1
α-helix	2493-2495	3
β-strand	2497-2499	3	2
β-strand	2504-2509	6	1
β-strand	2518-2523	6	2
β-strand	2529-2535	7	1
β-strand	2538-2544	7	1
β-strand	2549-2557	9	2
α-helix	2561	1
β-strand	2562	1	2
α-helix	2563	1
α-helix	2566	1
β-strand	2568-2573	6	2
α-helix	2575-2577	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Filamin-C	A	protein	138	Homo sapiens	Q14315 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2NQC_1 Filamin-C (chains A)
GSHMASMTGGQQMGRGSGSHMASMTGGQQMGRGSRVGEQSQAGDPGLVSAYGPGLEGGTT
GVSSEFIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGP
QHIVGSPFKAKVTGPRLS

Ligands and cofactors

ID	Name	Formula	Copies
NI	Nickel (II) ion	Ni	1

Water and common crystallization additives (GOL, IMD) are not listed.

Primary citation

Crystal structure of human filamin C domain 23 and small angle scattering model for filamin C 23-24 dimer. Sjekloca, L., Pudas, R., Sjoeblom, B. et al. J Mol Biol (2007) 368:1011-1023. DOI 10.1016/j.jmb.2007.02.018 · PubMed

Other PDB entries of the same protein (UniProt Q14315 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1V05 1.43 Å, Dimerization of human Filamin C: crystal structure of the domain 24
7OUU 1.47 Å, Crystal structure of human filamin C domains 14-15
7P0E 1.6 Å, Crystal structure of human filamin C domains 14-15 cardiovascular disease causing…
7OUV 1.8 Å, Crystal structure of human filamin C domains 14-15 cardiovascular disease causing…
3V8O 2.8 Å, Human Filamin C Ig - like Domains 4 and 5
8PA0 2.85 Å, cvHsp (HspB7) C131S alpha-crystallin domain - filamin C (FLNC) domain 24 complex
4MGX 3.16 Å, Crystal structure of human filamin C domains 4-5 and GPIB alpha cytoplasmic domain complex
2D7M Solution structure of the 14th Filamin domain from human Filamin C
2D7N Solution structure of the 16th Filamin domain from human Filamin C
2D7O Solution structure of the 17th Filamin domain from human Filamin C
2D7P Solution structure of the 22th Filamin domain from human Filamin C
2D7Q Solution structure of the 23th Filamin domain from human Filamin C

Browse structure collections

About this viewer

MolViewer shows 2NQC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.