2O6G: IRF-3

Crystal structure of IRF-3 bound to the interferon-b enhancer. Determined by X-ray diffraction at 3.1 Å resolution. Released 24 Jul 2007.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 6
Atoms: 5,951
Mol. weight: 91.72 kDa
Released: 24 Jul 2007

Explore 2O6G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2O6G contains 18 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain E: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	4-7	4
α-helix	8-18	11
β-strand	26	1	1
β-strand	33-35	3	1
α-helix	52-60	9
α-helix	73-86	14
β-strand	91-94	4	1
β-strand	106-108	3	1

Chain F: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	8-18	11
β-strand	25-26	2	2
β-strand	33-37	5	2
α-helix	48-51	4
α-helix	52-60	9
β-strand	66	1	3
β-strand	69	1	3
α-helix	73-86	14
β-strand	91-96	6	2
β-strand	104-108	5	2

Chain G: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	4-7	4
α-helix	8-18	11
β-strand	25-26	2	4
β-strand	33-37	5	4
α-helix	48-51	4
α-helix	52-60	9
α-helix	73-86	14
β-strand	90-96	7	4
β-strand	104-109	6	4

Chain H: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
α-helix	8-18	11
β-strand	25-26	2	5
β-strand	33-37	5	5
α-helix	48-51	4
α-helix	52-60	9
β-strand	66	1	6
β-strand	69	1	6
α-helix	73-86	14
β-strand	90-96	7	5
β-strand	104-109	6	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
interferon-b enhancer	D	DNA	57
interferon-b enhancer	C	DNA	57
Interferon regulatory factor 3	E, F, G, H	protein	123	Homo sapiens	Q14653 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>2O6G_1 interferon-b enhancer (chains D)
TAAATGACATAGGGAAACTGAAAGGGAAAGTGAAAGTGGGAAATTCCTCTGAATAGA

Sequence of entity 2 (C), FASTA

>2O6G_2 interferon-b enhancer (chains C)
ATCTATTCAGAGGAATTTCCCACTTTCACTTTCCCTTTCAGTTTCCCTATGTCATTT

Sequence of entity 3 (E, F, G, H), FASTA

>2O6G_3 Interferon regulatory factor 3 (chains E, F, G, H)
MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEA
TGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQP
DTS

Primary citation

An Atomic Model of the Interferon-beta Enhanceosome. Panne, D., Maniatis, T., Harrison, S.C. Cell (2007) 129:1111-1123. DOI 10.1016/j.cell.2007.05.019 · PubMed

Other PDB entries of the same protein (UniProt Q14653 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SJA 1.5 Å, Structure of HPV16 E6 oncoprotein in complex with IRF3 LxxLL motif
5JEL 1.6 Å, Phosphorylated TRIF in complex with IRF-3
7JFL 1.68 Å, Crystal structure of human phosphorylated IRF-3 bound to CBP
5JEO 1.72 Å, Phosphorylated Rotavirus NSP1 in complex with IRF-3
6SIV 1.75 Å, Structure of HPV16 E6 oncoprotein in complex with mutant IRF3 LxxLL motif
3A77 1.8 Å, The crystal structure of phosphorylated IRF-3
5JEJ 2.0 Å, Phosphorylated STING in complex with IRF-3 CTD
1QWT 2.1 Å, Auto-inhibitory interferon regulation factor-3 (IRF3) transactivation domain
1J2F 2.3 Å, X-ray crystal structure of IRF-3 and its functional implications
3QU6 2.3 Å, Crystal structure of IRF-3 DBD free form
2PI0 2.31 Å, Crystal Structure of IRF-3 bound to the PRDIII-I regulatory element of the human…
1ZOQ 2.37 Å, IRF3-CBP complex

Browse structure collections

About this viewer

MolViewer shows 2O6G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.