2QDQ: Talin dimerisation domain

Crystal structure of the talin dimerisation domain. Determined by X-ray diffraction at 2.2 Å resolution. Released 29 Jan 2008.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Mus musculus
Chains: 2
Atoms: 573
Mol. weight: 11.7 kDa
Released: 29 Jan 2008

Explore 2QDQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QDQ contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2497-2528	32

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2498-2527	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Talin-1	A, B	protein	50	Mus musculus	P26039 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2QDQ_1 Talin-1 (chains A, B)
GAMVGGIAQIIAAQEEMLRKERELEEARKKLAQIRQQQYKFLPSELRDEH

Primary citation

The structure of the C-terminal actin-binding domain of talin. Gingras, A.R., Bate, N., Goult, B.T. et al. EMBO J (2008) 27:458-469. DOI 10.1038/sj.emboj.7601965 · PubMed

Other PDB entries of the same protein (UniProt P26039 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9SR0 1.49 Å, Mouse vinculin head domain 1 (VD1) (residues 2-258) with A50I mutation in complex with…
4W8P 1.5 Å, Crystal structure of RIAM TBS1 in complex with talin R7R8 domains
9DZ5 1.74 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
7V1A 1.84 Å, Stapled TBS peptide from RIAM bound to talin R7R8 domains
3DYJ 1.85 Å, Crystal Structure of the R11R12 Domains of Talin
8FSE 1.9 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain
3IVF 1.94 Å, Crystal structure of the talin head FERM domain
3S90 1.97 Å, Human vinculin head domain Vh1 (residues 1-252) in complex with murine talin (VBS33;…
5IC0 1.97 Å, Structural analysis of a talin triple domain module
8FTB 1.97 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
2X0C 2.0 Å, Crystal Structure of the R7R8 domains of Talin
4F7G 2.05 Å, Crystal structure of talin autoinhibition complex

Browse structure collections

About this viewer

MolViewer shows 2QDQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.